GenomeNet

>tr:A0A0G0PH36_9BACT [A0A0G0PH36] RecName: Full=Thymidylate kinase {ECO:0000256|HAMAP-Rule:MF_00165}; EC=2.7.4.9 {ECO:0000256|HAMAP-Rule:MF_00165}; AltName: Full=dTMP kinase {ECO:0000256|HAMAP-Rule:MF_00165};
MKYPIDFELEFQRHNYPGKLIALEGIDGSGKTTQALELVESLKKEGIKTVYTKEPTDGEI
GKMIRRILTGEKNFEPVSFQYLFAADRVEHQEEIIGFLKKGKIVVSDRYFWSSIPYGATD
RGIDFKKSQDEANILLVCYSILSLYHQFIAPDITAYLEVSADAALKRLSAIRHNVDIYDK
LEKLKSIARGYEWLIRKFPRELTVIDGSKSIDKVSEELFEKVVKITS

BLAST