GenomeNet

>tr:A0A0G4MU16_9PEZI [A0A0G4MU16] RecName: Full=Urease_alpha domain-containing protein {ECO:0000259|Pfam:PF00449}; Flags: Fragment;
AAFLPAIGCDALLARLILHRPTFKSHEINLRISSQLVRAALPKMHLVPQELDKLVISQLG
FLAQKRLARGVKLNHAEATALITSNLQELIRDGNHTVSDLMGLGSTMLGRRHVQPSVCST
LHEIQVEGTFPSGTYLVTVHNPIATDDGNLARALYGYVPRMPSNDDFPLPEPAEFEPTAQ
PGALVAVKDVKVILNANRKHITLRVTSRGDRPIQVGSHYHFIEINPQLEFDRARAYGFRL
AIPAGTSVRFEPGDMKTVTLVEIGGNRVIRGGNGLATGGVELWRAGEIVEKLQQAGFAHQ
PEPVGDMGHISAFEMNRVAYATMFGPTTGDRLRLGSTNLWIKVEQDFTVYGDECKFGGGK
TLREGMGQATGRPDSESLDMVVTNALIVDWSGIYKADIGVKHGIIVGIGKAGNPDVMDGV
TPNMVVGSCTDVVAGENKIITAGGIDTHIHFICPQQTSEAXAALSATLSSHVSGLPPNCL
CIWSLPLQPWP

BLAST