GenomeNet

>tr:A0A0H4L178_9RHOB [A0A0H4L178] SubName: Full=Plasmid replication protein DnaA-like-II {ECO:0000313|EMBL:AKO99967.1};
MDAKRYTGPQAGSQKYDLLTALSVAGLSGSPGFQTSMLRLVALVTARYNWGRNELTVGQR
EMARLWSVDERTVKREIKRLTAASILLQLRPGVRGRVAAYRLNIAEIHRLSAPVWDRVGP
DYADRMAQQAPPSAAPTVTQVDFAAAQPADPPQQIDPPAGQGGPWARTLARLAQLEPALH
RSWFAALTPGACEAGVLTLRAPSQFQARYVQTHHQRLLLGTAQMEFPDLRRIEIYA

BLAST