GenomeNet

>tr:A0A0H4WLD2_9BORD [A0A0H4WLD2] SubName: Full=Fructose dehydrogenase small subunit {ECO:0000313|EMBL:AKQ56965.1}; SubName: Full=Membrane bound FAD containing D-sorbitol dehydrogenase {ECO:0000313|EMBL:VEH25360.1};
MELPDIPSGVPQARPRPSRQRRALLLGLAGVCVQTCLPGVAPAAPVADSAFLALSRVLTD
RQHLNPLTASRIQAALAGSGVRQAARLPELIALAASAADSAQLMQAARQAGLQDLAGDIV
AAWYTGTVGSGPAAVLVAYEEALMYQPVRDALTVPTYCSYGPMWWTAAPPDAAAMPPEPP
LLPTSKAL

BLAST