GenomeNet

>tr:A0A0J5GF97_9NEIS [A0A0J5GF97] RecName: Full=Chromosomal replication initiator protein DnaA {ECO:0000256|HAMAP-Rule:MF_00377, ECO:0000256|RuleBase:RU000577, ECO:0000256|SAAS:SAAS01081161};
MTEPENFWPACLTRLEEELSSQQFNTWIRPLSAEAGDEGVVLYAPNRFILQFIKDRFLAR
IEALAIELLGEVSVELRIGAAAGAPVAVARPAPASSAPRSNGTPAASVDVESAVAKVAAN
APAVAPTAKQTAVKAIGGGHESTRLNPSFTFDTLVTGKGNQLARAAAMQIAENPGDPAYN
PLFVYGGVGLGKTHLIQAIGNHVYLKNPQAKIRYIHAERYVADIMRAYQHKAFDEFKRYY
HSLDLLLIDDIQFFAGKNRTQEEFFYAFNALIEGGKQVIMTCDSYPKQIEGMEERLISRF
SWGLTVEIQPPELEMRVAILMKKAEADNTKLDHNVAFFIAQNVRSNVRELEGALKRVVAY
ARFSNQSITMELVKEALKDILAAGNRQVTIETIQKTVADYYKIKLSDMHSKKRSRDIARP
RQVAMTLAKELTSLSLPNIGDAFGGRDHTTVLHACKTIAEMRGNDSEIAHDYDTLLAMLR
N

BLAST