GenomeNet

>tr:A0A0J6NGG8_9NEIS [A0A0J6NGG8] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KMN77371.1};
MKLQLDAEVLADFVSALLGPDSEVAVHDLSDPSASLKIIRNGYVSGRSVGAPATDLALSM
ARECSGKGGEDYRLNYRSKTRGGVSLRSSTLVIKDEAGRAQAMFCVNSDDSRYKRALEAV
QALLPAELSHDPHQETLSLGIDDVGVGIMQGVLEQYAIDPARLSGDEKLEVIRELNQRGL
FSIRGFVGKASQALEISEPTLYRYLKLCRD

BLAST