GenomeNet

>tr:A0A0L8GFR6_OCTBM [A0A0L8GFR6] RecName: Full=V-type proton ATPase subunit a {ECO:0000256|RuleBase:RU361189}; Flags: Fragment;
FRFLAGVIHRERIPAFERMLWRVCRGNVFLKQAEIEPPLEDPVTGDHVYKSVFIVFFQGD
QLKSRVRKICEGFRATLYPCPETQAERREMAMGVITRIEDLNTVLGQTQDHRHRVLVAAA
KNIKVWFIKVRKIKAIYHTLNMFNLDVTQKCLIAECWCPVADLDRIQQALRRGTERSGSS
VPSILNRMVTKQEPPTYNRTNKFTEAFQAIVDAYGVASYREVNPAPFTIITFPFLFAVMF
GDAGHGFLMTLFAVWMIVREKVLSTKKGDNEIWNTTFGGRYIILLMGIFSIYTGLLYNDV
FSKSLNIFGSSWYTNKTVPKGSSIIFNPGTMYSSTPYPIGLDPAWQFSQNKITFTNSFKM
KTSIILGVSQMMFGVFLSLSNHRYFQKPLNVFCEFIPQIIFLSCLFGYLVILIFVKWTHF
DYSNAGTAPSLLIGLINMFLFKYPDTPLYEKPFYSGQPGFQGFLVVVAFLCVPWMLLVKP
YLLKKKHMAQQFEHQQLSVQSGDLVNHDQDAIIYAAENPEDTLHYSGQEPEEGVHTSGNP
APAVPLQDFDFADTLIHQAIHTIEYSLSCISNTASYLRLWALSLAHAQLSEVLWTMVMRK
ALSQSGYGGVIMTFMIFPLWAVLTVAVLLVMEGLSAFLHALRLHWVEFQNKFYQGSGYLF
QPFSFEHILDYGGDE

BLAST