GenomeNet

>tr:A0A0L9UAM5_PHAAN [A0A0L9UAM5] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KOM39955.1};
MENSLTNYGNVYEVDLGHSVKATMYMANDSSSCFLTNTNTTTDAIVTFRGNKYNVPAWSV
SLLPDCQTEEYNTAKVNVQTSVMIKGKNKAEDEPISLNWVWRAENIDDALLGRGNFSTNG
LVDQKIIASDASDYVWYMTRLDLDQSDPVLSNNMSLRINGTGHVIHAFVNGEHIGSHWAT
YGIRSYEFETKIKLMQGKNIISLLSVTLGLQNYGPNYDKWSAGLIGPISVISTKDDETVV
KDLSSNKWSYKVGLHGWDNKFFSEDSPYASASKWESNYLPTKRMLTWYKTTFKAPLGLEP
LLVDMQGMGKGFAWVNGHNIGRTWPSYDASEDGCSDDPCDYRGEYSDRKCVINCGQPT

BLAST