GenomeNet

>tr:A0A0M2NIE1_9FIRM [A0A0M2NIE1] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KKI52304.1};
MQKVAAERRRLGEEDVRIYERKKTARPQQRQQQRRSVSPTKTYERPTSIRQTGVKNMVGG
RNLTPAYEGARVTQRSYQQSYAQRAREVEEYYNTPNPNSLRSRQESYDDRYRYDGRYRYN
DGMRYEATTRPRSRYGGTAGNDYQRGYYDEKPRKAANYAGYKPAPKRKIIHGFDMDESNT
QQSANYSGVKPIAVEYEGQKRKGVVSTILLIAFVFAILSGIVIRYAAISSANNTNTQIES
NITELSAELDKLKMDIALKDDLNSIQQTASTKLGMSYPTEDQIVYVDPADDPPVATVQEE
AQSGGAAVSEPETVEQQQAADQSDAGIMGFLNSIVQGVKSLFQN

BLAST