GenomeNet

>tr:A0A0M3DFD0_9FIRM [A0A0M3DFD0] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KKY00963.1};
MGFFKRLKNVVEAKANKAIEKHEDPIEMLDLSITKKEKLLQDAKKQCANFIASVDNIRNE
KKSLEEKIEKYEQATKAALLKEDNDKAQGFVKQKLEMQDKLNKTIVRIEGQDKKIQEIKF
KIEELELEISKMKSKKQELATRLDVAEINNEINETLSGLSDDHGINLDELEKKVQEKESY
GKALETMKTKSEDDMLDEYINDSPVVDSKVEDELERIKREMNK

BLAST