GenomeNet

>tr:A0A0M4CXX7_SPHS1 [A0A0M4CXX7] SubName: Full=Phosphomevalonate kinase {ECO:0000313|EMBL:ALC13838.1};
MAPPLPGLDYYDQRFRSRPANEPVARIDPIEAEMRRERDRQTRLDLLLSASPDTVGRATT
IAKEIGVPPMHVEDRLAEAEKGRHVRRFMSVAERYPAIGKWAVTQPRGAAAASDDWDSLS
LLGKTWRSTREVATGIFPSLSSGLFTMAENVEGAIGAVSDTLDAIDPMPAVAGIFSDLIG
TYTGYNPRWDKSFAANQRIQREARAKRQAELAREAEDWRPKSTSWIARELLAGTESIPMS
AAALITRDPKQAAGVFGTLTGAGEYQKARDAGLDLGSSLAYGARQGAVEALTEHIPAAKL
LGDIAARSPLGKMLLNQLVREVPGEQVATLLQDFDQWVTLNPDKTLGEFIAERPDAARQT
LLGTIGAVGTTTAVVRATQKVAEGSAMIAARRGEADRALREGDILAKAGAAAEKSKLRER
DPEAFAALMRELAEDSGATDVYIPAEAIQQYMQSDGFDPDSWAEFEEESLEAMATGGDVV
MPVERVLTAFPGTPAWEALRDHMRLSPGGMSRFEAESFNLEVAELRQTMEEQAAAVEEYD
REMMEAREALLTDVTEKLQTAGYTPSVARTQAELLAARYETRAMRKGQRLTGREFADVDV
VQILPEKLALRQKNDGLDRVIDAMRRGTEGAKRGPSLLEFISKRGGIDDVGGDIASMGGD
KWHRSAPFRKRLTRSVDKGQASMLSAAASDTAPEDVFRAAISAGYFPELAGREEGTYDDA
LDNRMLLDAIGEELRGNARYAEEVDTTLTDAAQELATLLANEGLDPASATRKQIRDAIAA
YSARNANEGRGYLQAGLRDDIQAAWSGTKTRGFIDLGPVPQALVDFGLPAGKLQIGRGKI
NAIANKHDLEVGDVASLAAMLEQPWAIYPTTLKDSNRVVVALPVRDRNGDPILCVIEPNG
KVATVTSVYGKKGRGSVTGDDTIRAAIANARAKGLEVFEGAPPARDPEPVSGIMPEKRRR
PILSLPQNGKPTSLEQSGDEKAPRGRIVFPSEEFTGAALIELFKSRNLSTFLHETGHLWL
EELRYDALSEDATNRLKDDWATVQDWFAANGHPIENGVIPVEAHEMWARGVEQYLMEGKA
PVPALRSIFEQFRAWLTSIYRSVKALRSPLTPEIRRVMDRLIATDDDIALASREQSVQPL
LTDGTDMTKAEWEAYQRLTADARIEARGQLLDKTVRDVRARNTKKYREMAAELREEIEAS
VDERPAFRAIAAMRAQPIDRRWVVNMMGEEAAAYMPRGVPPLMRNGGVHPDTIAEQSGFA
TAYEMIEALTELEIAHRTAREEGDQRGLRERIIEEELDIMMRDRYGEPLTDGSIEREAIA
AVHNDLQGEVIAAEVRVLGRKAGEPPTPYSAAQEWARQKIRSGKVSVEAMPGALQRYARA
SKRAAREAEAAYLERNIEGAFRAKQQQMLNNALYSEAKKAHEEVEAARQRLNKIASKRVM
KSVDQEYLEQAQALLEAVDIKRRTQKGITRQGKWEEWSQQRQAEGYDIVVPSSFEATIGK
ENWTRLTVEHFLGLDEAVRQIIHLGRLKRELQDGQDKREFELTVTQAVQAVAKLPQRPPS
DLMEPSRWDAIKSKVAAADAALLKMETVFDWLDSGDSNGIFNRIVFRPLVDAQENERIRM
NDILGQLRAALEKVPADTLKRWSDKITAPELINRETGNPFVMTREMVIAIALNTGNSGNY
EKLLGGYGWSATGVEAMLARVMTQEEWAYVQEVWDIINSLWPDIEAMEKRVNDIAPEKVE
ARPVQTKWGVLKGGYYPVVYDPRRNYESESYAAKGDSLFEGIYTRATTPKGFTKERTNVE
RPIHLSLGVIHRHVGEVIHDLTHREAIMQADKFLQARPVMKAVDDSLGPEVRKQFRPWLQ
RIANEWAYDRAGQAGVEGFVKKARLNATIVGMGFRATTILLQAAGYSNSFETVGLRWVSR
RLKDVGNPEAWNFVLEKSKEVRARMDTLDRDIRDNVRKAAGQRNLSAIKKFAFHGIGYMD
RVVVIPTWLGAYDKAIAEGMSEDDAVYAADKAVRQSQGAGAAKDLAAIQSGRGTFGEAAK
LLTMFYSYMSAFYQRQRSFARDVRAAKLSDGPGLLARAWWLFIVPPLLSELLAGRTPDDD
DDESWAEWALSNIIFQIFGPVPVLRDIGPTLWAKATDRPTFGYRFTPAQGGVESIINVGS
DLGKIWRGEETKRATRNAIETTGYFTGLTTGQMAVAAQFLVDVGSGDANPDGIGEWWRGL
TTGKTD

BLAST