GenomeNet

>tr:A0A0M5L634_9ACTN [A0A0M5L634] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:ALE18835.1};
MAFATKHPMSRVVSLASAVALSLATLVPMSSMAPASAAPQAAPSSQWIKSTNYKYPGNDG
KRHKVTWDKYSYKVDGQRLNIWSGEVHYWRLPSPNQWRDVLQKMKAAGFNAVSFYFFWGY
HQSAPDAPFDFSGVRDMDLLLRMAAEEGLYVIARPGPYINAEISMGGMPAWQTNSALPLR
TAWDKTNWKEQRAWLRAINRILARHQVTNGGGSVLMYQAENEELFSLGPYADYVKKIIKA
AKEDGINVPIFHNDYAPLSNWAFNTKDTGLDVYSYDDYPIRFDCSAERQELSDHNWHIDP
AFKAANNSPHFIAEAQGGAFTPWGASFNASACEKFVDANFYRQWAALNNGAGVTAFNYYM
IFGGTNWGWTGSAHSGFTSYDYGASITEDRNLRDKLSVQKENGYFHRAFPQLVVMDATSD
PAVNNVYGAKVKSYLRTSAGMRNLSMSGKGSQYMAFRLASSNDTTLTKFTTSLTTYAPNG
QKVTFNRVPQEGQLILHGRDALQMPVDFTIGDWGAYYSTGLLFFNSSMKGRPLAVLTGTA
GDRGEIVLHAPTKPVVKSGNKSVTYTWDKTKKQLRINYDWGFPYDIKVSMKGKAPLTLRI
ADRHSLIRSWSPQNWLNGKIQGILVENADLVRSVRYEGTTAHLVGSTTKPQNIKIWLPQG
ITNATWNGQALPLEKAGTHYRAALPGPAAVSVPRLKWVKHEEGYEANPNFDDSRWRVANI
KHPKNFRQGPGFFQDVVLDANAYNFHEGDIWYRAHYTAATDDPAIWVKAFGAPGSNFLVW
MNGKYVGASAAVKGSVADTGLDNESSKDPTANLAESPKSISFTVPRGTVKKGQKVVLSIL
LRNNGQRVDWEGTGNNLHAMGVLDARLGNQGKVTWKIQGARGGIHPVDNVRGIYNNGGLY
GERAGWHLPGFPDNTWKPAATMHASKPGVTWYRSDFTLNFPANQDVMLRLNVKSKRFHPN
RKDKARTVMFVNGWNVGTWVGNVGPQESFTIPAGFLNRNGKNEIAIAVTAEGTGYGPETI
QLGVIGNWLGSIPWKENKAPGYQQLKHNLMAAYPQIRMATVKQS

BLAST