GenomeNet

>tr:A0A0M8MYB8_9HYPO [A0A0M8MYB8] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KOS16824.1};
MPVAPIITFKAGECLVDTSSKPYKITPLAEPGYVYLYSEDVHFCWRRRDQSLEDPKLDLV
MVPTDGQFVPYEYTTTPQPSSKTNGRIFVLKFASSSQRYLYWMQSKPQGRNGDASYFSPR
DRKIGDLVHRLLQGEEVNVASELAAVRNTDDRRDDDGGDDETMEDAEPRERHSGSRDRHA
GGSGGAGADATGGDVREEGENSREGGADGARAASASTTDAQAAVRDFLDSLRGQAGLSEG
QQQQQQEHGDKAYPHLHHLLPTSITIPLADTLSVEQVDTLLKLLPPSIVMLAAQASDGTA
EPTEEQLAAALGSLSPDRKKGLLKSVLRSPQFHQALAGLTMALRDGGLPSIAEALGVAVE
QGGYFRPGMPLGGGFAVEAFIEGVKKTVQEKGR

BLAST