GenomeNet

>tr:A0A0N0GR26_9NEIS [A0A0N0GR26] SubName: Full=Polysialic acid transport protein KpsD {ECO:0000313|EMBL:KPC55268.1};
MYSAKKFFRRWARWVLALFIFSAGLIAAPMANAMCTPGDSACVMPATASASPAPAPTVSP
RLPAPAVRPAPPPATPADCAHTELTLQRYLCQTADQFLPVYGLDLFSRDAQNGFGAEAVA
VPADYLLGVNDTFNVRIWGQLESDLTLTVDRTGAIFIPRVGAIHVVGVPFGSLKGHLDAA
IGNVFHDYDLAVSMGELKQQNVFVVGFVRHPGSVSVSSLSTIVNALYAAGGPSANGSLRQ
VQLKRGGVVVRTLDLYQLLLRGDKRGDVMLQAGDVIHVPPAGAQVALLGAVRQPGIYEAL
PNESLQALLDMAGGTASEVLDQPVSVERIVAQQHRVIQNVPLPQLAGYALKAGDIVRFYH
LSGQVGQSVALRGNVAQPVRRAWTEGMRVSDLITSRDMLLDPAFWLRRDPPAQLAATDAG
TVRRNLTAAADEINWHYATIERLDPKTLTRKLLPFDLAQAIDHAPDADLPLQADDIVHVF
SRADIEVRSDDKSRYVRLEGEVAVPGIYEVQPGETLRDLVARIGGLGPQGWLYAAEFTRP
SIQQQQQRELDRMLDELHAQNQRQSAEQAAAPSPDNANAAADARMQQQANEQMLRRLATQ
KATGRIVLGVSAEATAVTALPGLPLEDGDRFYVPPRPSTIAVVGEVYNRHGAFAFDQGKQ
IGDYLDLAGGATGHADTGQMYVVRADGSVVSAAQRRWPGKLGSLIARPGDTLIVPTQLIQ
PSGMRVALDWSRILANFALGAVAIKVLGD

BLAST