GenomeNet

>tr:A0A0P6Y038_9CHLR [A0A0P6Y038] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KPL78694.1};
MEHIVQSKPPSFKVTGYRDAWQMVLNQLQMEMSRTLFDTWVQPLHPLGFKEGVFTLGAFN
PYARDWVDNRLRSRITRLLEGVFGEAIDLRVVVSNGFSNQPAAESEQDESEEESDGDTAI
SDTLPEDIEPGKKTKKVAAKPAQPSPRKVMLQRAYGSKRAAVIQPERGMFVTLYFLQQWQ
PIIGHSAVAIILASRSMCYWNPLTGELRNEVETEMAELAKRAAVSVRTVKDVLNQELVKQ
YFLRYRVRRVMTPNGIRTAGIILQVRMDDPLTPEDQQEHGLQEEEHWYSVEFDGEED

BLAST