GenomeNet

>tr:A0A0Q0U5E1_LEULA [A0A0Q0U5E1] SubName: Full=Cytochrome C oxidase subunit III {ECO:0000313|EMBL:KQB81037.1};
MVAQRAGNKAEQHVSQMGFWDQLATWIGANANNGTWYMGGVLAALGFAGALGVILISGPL
AYLFLALVGYMGYKLRASTMNLMRPAFGLRGSIGPSLINVIQFMGWAAVNTYIAAISVSY
LLSNMFGTAHFKPGGLKGMLIGVAVMGVLHLISISLGQRSVRLIERVGMVLVILLVIWET
VVVLQEVPLSKIMTWTAPSAAHLPFGKALDVFAAFNLAWVTAGADFTRFADKKSAATTAP
FLGATIGLYWFAIVGAMTTIAAAVWTQVFDPNSSDPSTVAAKLGLGALALIVIMLTSTTA
NAVNLMAAGSALNNIVPKLKLTPSLWLVTIVATLMSFIPFIVGGFIETFIWFLDLIGMVL
GPEIAILLADFYIVQKQNYDRTAFNQGKTYWYTGGFNLRAYIVWALSMGCYFVLQQVPVV
VQTVGSNWLTMIFAAVVYVAVSRNQTKML

BLAST