GenomeNet

>tr:A0A0Q3W0N6_AMAAE [A0A0Q3W0N6] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KQL34498.1};
MSWAVEEWKEGVSPKVLQKIHELESQVDKLRKERQQRQFQLETLEAALQKQKQKVESEKN
EASLLKRENQSLMELCDSLEKAKQKISHDLQAKESQINIQSGQLNSSKKDIERLEQELKR
YKCELERSQQXSIAGDLSFSGAPQKSFTAPLTPVQSHNDTKFEELEEKYKKEVQERKKLE
LELRAIQVQDLEQQLQAQEKXKKSHMNKHQXTEQQLVRIKLELAEKDKXLNKTRDKLTQT
RTQLDQATTQVQMMEQKVKRLSEELNCQRQNAESALQSLEQKIKAKEKEXQQELSCQQRS
LQTLDQQCNQIISKLHQELQQAKNDFNALQAEFDKVMAVKQRLECNTSDLTQKLCRAEQA
LLAAQTKETDLTRSFEEVKQEKNLLDCQLGKKLQAIHQLEEDLKMINQSLKQSQRFAEEM
KIKNXVQEAELKLLEEKFKKQESSLLLEKLQVALADMEKQQGSTQDLLKEKENYIKEQNY
KLSKMEEESEALQKLLGFKQXECEELQKXATAFSQWKSESDHXINELKSEKESLLARIND
LERTLQSQQIKTREHSEKLGMMQTENDRKSREIGELRDMLECKSAELEEQKKAFAEVQWK
AECSDKKYCKEIENMTCKILQLTNQVGEAEEKLQLAASEGLQKEQCYHELLSEYEKICHL
VKAKDASKMTEDGEVDLKSGQDNIQLAANNSIADNHGCARXLLEPXQTKNLAILQDQISS
LEISLMGQKQLNSNQHQQYEDLLQKKDETEARLLSAEKMHESFVTETKQHIXNLQADISA
HQKLVEEKDMQLQTLNERLEKRQAELQDLKVNNELLEDSVRQLKLLSGTWDSEKKDMSSM
ICSYSKQIEELTEENTSLRNLSRTLXQGQVTLLEANKDISDSLKERDEIISELSRKHKEE
RQXIESRTEEIKSELEVLQAKHKSMEEENANMKSILREHTIEFEEKKAKLXQEKQLFREN
KDILHKLIASEEIKKDLVQQLQQLQSEFSNTQNVPLTELECSRQEMLNVRAAPNTMQEEC
DILFQDKEQLGEKLEXESKPLMCDVRCEQRLHPEQLRKSIEEKXIELKKYQVKLELLQMD
FEDRELSLENYRLEVMQLETALKGIEVELEKSMREKERLQELLSVKELKASDDDGHSLEP
KYDDDSQNCDKRGTEESFSSLLLASSLQVTLNNLTKLEKMCERLQVENIALASGFEDSKN
NGRTGIDKVAEEKENIMNADRNLKAEEAVFPDELMDQSDSSDLRMYSGNKEMSFXLKECS
TGXSLDYKDLKLSSKEVKIHFAEVREKLLSFQNEHIKLYEQHCSMSSKISELQSCIEMLK
AENSALSTSMSNAHAASVRGPLSSSQXDMLPKSEETKSTVSSSGLLESPCFIEMTDPETS
TPYRLAVPTENSALKNKRCKLIPIEKMAVGGTSVCENATETTVARLMENYTEISGDHESR
NMSGKITSPSDHASALSVSNNRMRLSAGYFSENQITTEMLQKEAKQQTAEXLKLISKMEG
SHKHVDLLMKVEQLNSELNFQNPQLASKSSAFAELEEAAVVVKEENCGIKEILESASINN
QQFSFTVENEXENINSELEVYXVTFPNGADTLDDVEMTKRDCPDQFLAAENEKRSPKSEQ
GNIKNHVXFTEHDTEMLQTKXQRLERETVVNLKTIPSFQEHLVSXTAERNHVNQELSILT
ENKKELXQKXQKLQEKLKELESTNADSAEFIRRLEGEVRTQTNLLETAKSXVNQLSNEKE
HLLQKLRSLENDVVSFALEKGKLQNEAADLKKEKELIVRELEITQSKLSLSEMENSKFSS
SLQGLLMEKRELAARVSSAQEEVDQMRCGIEKLKVRIELDEKKKLXIAEKLKESERKADC
LLDKIERLERELEMSEKNLEDAIIQLETAKAEAETVAVEMEEMTEKVKCLNAQIDVLASQ
KECLAKDLKEKQERILELEAEKLTTAKLLEEKEEEKLQIKAEFENAXALLKSELKEMSEK
LEEEGGARAKEQVLINQVAHLEQDKTXLLQECQELQNENIRLDQMREELVQELMLCKQKL
SEKVQEHSDLEKEVKETDELSLQLTHMHHEHAHWQQEKERLLNLVAELKLKEQHFPENET
FPAILNGLKVSYKNLEKELESTRCEKSTLCEKVNELMESHSELRVKLSDAEQKISKLQEE
FTXERDKXAEEIQLTQEHAEKSKIQLHQTMSEKNELTKRLGMVQKELQEKVSEMKREISE
YKTRLLQAEKTHQDALXEANRKNEAEIEACQDKMNSLEHFISSQKLEIEHLKSNKEELNN
SLKEAKQTLEELLKTKADNIIVQQKKEDEFTQXEVQLWMKSCKQMEQEKEXLQKQLVERD
ELLNKKNLAMTECTKEGADDYADMEEMKLKLEELQEFTEVKTREANENLEKYCSLIVKYY
KLEEENEMLKTQVSLLSAQLKQPTSDLVSTPLLNSXNSLTGSNQSVKEMRAAEDATKRSS
KRQRHEDKRKGNGEPRSPVPETLSKRKRKDDVCQGLLGEESADSEPDGLPEAVKKGFAXI
TSGKVSAYILHRTTLNQRTSPHLASPSEKLPLPMQDVQKRRPDNLGERSSSTSGGSKPQK
VYDEEKSQTVTAFSPMQSTSRSPLCPYKQSTKSASDNTTESHMMYKAKNSLNQQGLPEQD
EXKENCKVQ

BLAST