GenomeNet

>tr:A0A0Q4JJ80_9SPHN [A0A0Q4JJ80] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KQN10135.1};
MESCAPFDAAQGYAMALTRYVDCQATLLGEGGYAALSASNSPIIIALGGLLTILIAFQGY
RLLLGEQLVLRDGILLAAKIGLVLAFATQWSAYRSVVYNLAIEAPQEVVALLPGAGGGSG
RSFPARLQTSYQTIAELTRPSPNAPPAAVAASQEGTAVAPTAPAAAPILSYSLAGNPLLT
TAGILLLVSGLAVLVTVRLVAGLLLALGPLFFACLLFDTTRGLFEGWVRALLGTAIASVA
TGVLLGIEMSIVEPQLANVIGAMMAGTLPVLAPGEILATILIFTLATLIALAISLKMGAG
FRFLERGWALGARASERWRAMAPAAAPRTETLGNPTRSQEEGRSRAAMMSDAIKISDQWW
MRPALAGTGPDPARRIEISDRGTIEPPPTPLGQSYRRTGNQRRTKSMSQRNSRT

BLAST