GenomeNet

>tr:A0A0Q5UQG6_9FLAO [A0A0Q5UQG6] SubName: Full=Translation initiation factor SUI1-related protein {ECO:0000313|EMBL:KQS45991.1};
MDLHDQLKKLFPDHQPSEEIEETESEPKELWVQAEPMICKFEKRKGKPTTIIEGYTGSDD
DFKILGKELKTKLSVGGTFKDDSIIIQGDYRDKIMTILKEKGFKVKRVGG

BLAST