GenomeNet

>tr:A0A0Q6LYN5_9RHIZ [A0A0Q6LYN5] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KQU69144.1};
MPQIGLFTREGDSFSGRIHTFTLDLELTIVPVEPGDGDNTPDYRVLRGIDDGQDVGAGWT
RTSEKAGEYVSLQIDDPTFHEPIRARLFRKGDDATSWSLHWSRPRDRSETA

BLAST