GenomeNet

>tr:A0A0Q8NM07_9RHIZ [A0A0Q8NM07] SubName: Full=Sugar ABC transporter substrate-binding protein {ECO:0000313|EMBL:KRB61947.1};
MRDCFIESRAARKRALRSSIVLVAGLTGVLLSSSIASADDYRLGVMDKLKIRVAEWQTAD
GTIRDWSVVSGDYTVGPSGSISLPFVGDMPASGKTTDAIAQEIGTALQKQFALKDRPSAS
VELSEYRPVYLSGDVEKPGEYPFAPNLSVVKAVSLAGGLRRADAGQRFARDFINAKGDAV
VYMADRARLLVKQARLKAEAADQEGFETPKELQDKPEAKALVASETALMKSRKKRLTLQL
QALDDLRALLQSEVETLAKKTETQSRQLQLATEDRDKVEDLAEKGLALSARKMAAEQRAA
DIEATLLDIDTNSLKAKQDISKANQDEITLRNDWDAQLAQELQSTEAQLDELDLKLQTSN
SLMSEALTQSTDAARFDTTSGAASIAYSIIREVDGKPQEIPVQENTALQPGDLIKVTAGL
YMR

BLAST