GenomeNet

>tr:A0A0Q9W2H0_DROVI [A0A0Q9W2H0] SubName: Full=Uncharacterized protein, isoform N {ECO:0000313|EMBL:KRF79240.1};
MAEAEGGSEQDDVSFLRTEDMVTLSCTATGERVCLAAEGFGNRHCFLENIADKNVPPDLS
QCVFVIEQALSVRALQELVTAAGSETDSQVGKGTGSGHRTLLYGNAILLRHHNSDMYLAC
LSTSSSNDKLSFDVGLQEHSQGEACWWTVHPASKQRSEGEKVRVGDDLILVSVATERYLH
TTKENEQSIVNASFHVTHWSVQPYGTGISRMKYVGYVFGGDVLRFFHGGDECLTIPSTWG
REAGQNIVIYEGGVVMAQARSLWRLELARTKWTGGFINWYHPMRIRHITTGRYLGVNDSN
ELILVKKEEASIATTTFCLRQEKDDEKKVLEDKDLEIIGSPIIKYGDTTVIVQHCESSLW
LSYKSYETKKKGVGKVEEKQAILHEEGKMDDCLDFSRSQEEESKTARVIRKCSSLFTQFI
TALETLQSNRRHSVFFQKVNLNEMVMCLEDLINYFSQPEDDMEHEEKQNRFRALRNRQDL
FQEEGVLNLILEAIDKINIITSQGFLASFLAGDETGQSWDLISTYLYQLLAAIIKGNHTN
CAQFANSNRLNWLFSRLGSQASSEGSGMLDVLHCVLIDSPEALNMMRDEHIKVIISLLEK
HGRDPKVLDVLCSLCVGNGVAVRSSQNNICDFLLPGKNLLLQTLLVDHVASIRPNIFVGR
VDGSSMYQKWYFEVTMDHIEQTTHIMPHLRIGWANTSGYVPYPGGGKKWGGNGVGDDLYS
FGFDGAHLWTGGRKSLVVDALPEEPFIRKGDVIGVAIDLSVPVITFTFNGAKVRGCFRDF
NLDGMFFPVMSCSSKLSCRFLFGGDHGRLKYAPPMGFSALVQCLMPHQILSLDPCFYFGN
LSKNVLAGPWLIEDDTPFVPKPVDTTGVSLPSSVDQIKEKLAENIHEMWALNKIDAGWTW
GEHRDDYHRIHPCLTQFEKLPAAEKRYDNQLAVQTLKTIISLGYYITMDKPPARIRPVRL
PNEIFMQANGYKPAPLDLSAVTLTPKLEELVDQLAENTHNLWARERIQQGWTYGLNEDSE
NHRSPHLVPYAKVDEAIKKANRDTASETVRTLLVYGYVLDPPTGEGTEALLAEAQRLKFA
AFRTYRVERNYAVTSGKWYFEFEVLTAGPMRVGWARADCYPGAMLGSEDTSWAFDGHNEE
KVYGGNSESFGKQCGPGDIVGVFLDLADHTISFSLNGELLMDALGGETTFADVTAEGVGF
VPACTLGVGQKARLIYGQDVDSLKFFTTCGLQEGYEPFCVNMRRPVTHWYTKDQPIFENT
EEMPDCRIDVTRIPGGADTPPHLKISHNTFETMEKANWEFLRLSLPVTCMSDFISEQEKA
RRWEEIKIRQYRLMREAQEAAAQMQTQTVAHMDHMLKGGFNMNDIKGLTRNFDDHAEAEA
EHMMRVPSRPSRKGSLTRNITFESDMTAALDEMQRSSSVLDINGLGDDLDDKKKRGRSPF
KFFSKKSRDQSREKNGARTADASLERRNTVAHGRNVVNQQMTTRTPTLRLNNAEIPPSPV
PQGPKQLSSSNLGQPPVESSGNEMFDAECLKLINEYFYGVRIFPGQDPTHVYVGWVTTQY
HLHSREFNKSKVRRGSVYIEDYYEVPIERIDRQSCYVVRADELFNEVTQDASGKGASQGM
FVGCFVDTATGIIRFTCEGKDTSHRWMMEPDTKLFPAIFVEATSKEILQIELGRTPTTLP
LSAAVLPTSDKHINPQSPPRLKVQCLRPHQWARVPNTSLQVHALKLSDIRGWSMLCEDPI
SMLALHIPEEDRCIDILELIEMDKLLSFHAHTLTLYAALCYQSNYRAAHALCQHVDQKQL
LYAIRSEYMSGPLRQGFYDLLIALHLESHATTMEVCKNEYITPLGVELKELYAEDEMRHS
LRSLVTESVRPQLRMTEITVSSEPIPNIDQLYSPKFPLEVVREFVMEALKDAVEINQVHN
RDPIGWTNENLFLPLIKLTDRLLLVGVLTDEDVQKLLVMVDPETWDATFEKEGKDEHRKG
LLTMKMAEGAKLQMCYLLHHLYDTQLRHRVESIIAFSHDFVGDLQTDQLRRYIEIKQSDL
PSAVAAKKTKEFRCPPREQMNQILCFKNLEVDDQDNCTCGLELRSRLSEFHDCLMQKVSL
NALQEPDGTESNAIEEIKTGPITKIYNFINTVKELEEGPKEVEEPEKKTPEEIFRKVLIK
TIVSWAEESQIENPKLVREMFSLLVRQYDTVGELVRALEKTYVINNRARDDVAEMWVGLS
QIRALLPVQMSQEEEELMRKRLWKLVNNATFFQHPDLIRILRVHENVMAVMMNTLGRRAQ
AQSDAPTQTEGAEGVPSKEKDTSHEMVVACCRFLCYFCRTGRQNQKAMFDHFDFLLDNAN
ILLARPSLRGSTPLDVAYSSLMENTELALALREHYLEKIAVYLSRCGLQSNSELVEKGYP
DLGWDPVEGERYLDFLRYCVWVNGESVEENANLVIRLLIRRPECLGPALRGEGEGLFRAI
VEANRMSERISDRCKMQDEAEGTIAGLNFTHPLPEGDEDEDYIDTGAAILNFYCTLVDLL
GRCAPDVSVIEQGKNESLRARAILRSLVPLEDLQGVLSLKFTLTQTAPGEERPKSDMPSG
LLPNNKQSIVLFLERVYGIETQDLFYRLLEDAFLPDLRTATILDKSDGSESDMALAMNRY
IGNSILPLLIKHSKFYNEAENYASLLDATLHTVYRLSKNRMLTKGQREAVSDFLVALTSQ
MQPAMLLKLLRKLTVDVSKLSEYTTVALRLLTLHFDRCAKYYGSTQGQGSYGASSDEEKR
LTMLLFSNIFDSLSNMDYDPELFGKALPCLIAIGCALPPDYSLSKNTDEDYYGRQMGAPD
QPQYVPNPIDTNNVHLDNDLNSLVQKFSEHYHDAWASRRLEGGWTYGEVRSDNDRKHPRL
KPYNMLSEYERERYRDPVRECLKGLLAIGWTVEHSEMDLPLNHRGSTRRQSKPTIHDFQN
EGSPFNYNPHPVDMSNLTLSREMQNMAERLAENSHDIWAKKKNEELDGCGGVIHPQLVPY
DLLTDKEKKKDRERSQEFLKYMQYQGYKLHKPSKGGAVEEGGATQAAVELRFSYSLLEKL
IQYLDRATINMKLLKPSTTFSRRTSFKTASRDIKFFSKVVLPLMEKYFSTHRNYFIAIAT
ATNNIGAASLKEKEMVASIFCKLAALLRNRLSAFGPDVRITVRCLQVLVKGIDAKTLTKN
CPEFIRTSMLTFFNQTSDDLGNTIMNLQDGKYSHLRGTHLKTSTSLGYVNQVVLPVLTAM
FDHLAACDYGSDLLLDEIQVASYKILAALYHLGTDATLTHDRKYLKTEIERHRPALGSCL
GAYSSCFPVAYLEPHLNKHNQYSLLNRIADHSLEAQDIMVKMESCMPNLEAILSEVDQFV
ESDKTYNDAPHIIDVILPLLCAYLPFWWSQGPDNVSPTSGNHVTMVTADHMNSLLRNVLK
MIKKNIGNDNAPWMTRIAAYTQQIIINTSEELLKDPFLPLAERVKKRTENMLHKEESMRG
FIKSATDDTSQVETQLQEDWNLLVRDIYSFYPLLIKYVDLQRNHWLKDNIPEAEELYNHV
AEIFNIWSKSQYFLKEEQNFISANEIDNMALIMPTATRRSAISEGVPAVGGKVKKKKKNR
DKKRDKDKEVQASLMVACLKRLLPVGLNLFAGREQELVQHCKDRYLKKMPEYDVIEFARN
QLTLPDKLDPSDEMSWQHYLYSKLGKTEETVDEQALEKVNTNSNEKGKDKTTETVDRIVA
MAKVLFGLHMIDHPQQQSKNVYRSVVSIQRKRAVIACFRQTSLHSLPRHRACNIFARTYY
EQWLQEENVGQEVMIEDLTQTFEESEKSKKDEEEADGKPDPLTQLVTTFCRGAMTERSGA
LQEDLLYMSYAQIAAKSCGEEEEEGGEDGEAGEGGEEGEGTSIHEQEMEKQKLLFHQARL
SNRGVAEMVLLHISASKGIPSEMVMTTLNLGIAILRGGNIDIQMGMLNHLKEKKDVGFFT
SIAGLMNSCSVLDLDAFERNTKAEEYIPSAGAGLGVGSEGAAGEKNMHDAEFTCALFRFI
QLTCEGHNLEWQNYLRTQAGNTTTVNVVICTVDYLLRLQESIMDFYWHYSSKEIIDPAGK
ANFFKAIGVASQVFNTLTEVIQGPCTLNQQALAHSRLWDAVGGFLFLFSHMQDKLSKHSS
QVDLLKELLNLQKDMITMMLSMLEGNVVNGTIGKQMVDTLVESAGNVELILKYFDMFLKL
ADLIESPSFHEIDMKNEGWVIPKDFREKMEQSKNYTPEEMDFLLACCERNHEGKIDYRAF
VERFHEPSKEIGFNLAVLLTNLSEHMPNEPRLARFLETAGSVLNYFEPFLGRIEILGSSK
RIERVYFEIKDSNIEQWEKPQIRESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIFEMTHA
SGLMATDDGGSNVKRDTAYSSYMSEEEEERAARDPIRRTITAVKEGLKFGVHMLSPSNIK
HQIGVMQTKSIPELIVGFFKIIFYMFYYTGYAHYCVVRYIFGILLNLMRGPAPEQEEEEA
VVEEETFGRALPPLPLEEPPGTVQAFGLDINKEENGMYKVVVHESPAGSSVEEGGESSPE
DGAAATAEFIEGEPYQEPISIVDLLGGEAAKKAAQERQEAQKAQEAAMASIEAEAKKSSA
APQETPAVHQIDFSQYTHRAVSFLARNFYNLKYVALVLAFSINFMLLFYKVTSYPEESEG
SGEDELILGSGSGGGADVAGSGLGGSGDGGSGDGDFDEDDIPELVHVDEDFFYMEHVLRI
AALLHSLVSLAMLIAYYHLKVPLAIFKREKEIARRLEFDGLFIAEQPEDDDFKSHWDKLV
ISAKSFPVNYWDKFVKKKVRQKYSETYDFDSISNLLGMEKSAFTAQESEETGILRYIMNI
DWRYQVWKAGVTFTDNAFLYSLWYFSFSVMGNFNNFFFAAHLLDVAVGFKTLRTILQSVT
HNGKQLVLTVMLLTIIVYIYTVIAFNFFRKFYIQEEDEEVDKKCHDMLTCFVFHLYKGVR
AGGGIGDEIGDPDGDDYEVYRIIFDITFFFFVIVILLAIIQGLIIDAFGELRDQLESVKD
NMESNCFICGMGKDFFDIVPHGFDTHVQKEHNLANYMFFLMHLINKPDTEYTGQETYVWN
MYQQRSWDFFPVGDCFRKQYEDELSGGGGGGG

BLAST