GenomeNet

>tr:A0A0Q9X8P4_DROMO [A0A0Q9X8P4] RecName: Full=V-type proton ATPase subunit a {ECO:0000256|RuleBase:RU361189};
MGSLFRSEEMALCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE
MERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKR
NFLELTELKHILRKTQVFFDESVPMVYKSTSTYSSNKYRRYLQMADNQNEDEQAQLLGEE
GVRANQPGQNLKLGFVAGVISREKLPAFERMLWRACRGNVFLRQAMIESPLEDPTNGDQV
YKSVFIIFFQGDQLKTRVKKICEGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQT
QDHRHRVLVAAAKNLKNWFVKVRKIKAIYHTLNLFNLDVTQKCLIAECWVPLLDIETIQL
ALRRGTERSGSSVPPILNRMQTFENPPTYNRTNKFTKAFQALIDAYGVASYREMNPAPYT
IITFPFLFAVMFGDLGHGAIMALFGLWMIRKEKGLAAQKTDNEIWNIFFGGRYIIFLMGV
FSMYTGLIYNDIFSKSLNIFGSHWHLSYNKSTVWNNNYLQLSPATSDYEGTPYPFGMDPI
WQVASSNKIVFQNAYKMKISIIFGVLHMIFGVIMSWHNHTYFRNRLSLLYEFIPQLLFLV
VLFFYLVLLMFIKWNRYAATNAFPMTEACAPSILITFIDMVLFKNSKAPGKDCNIYMFAG
QSFFQTIFVLIALACIPVMLLGKPIKIMQARKLANVQPITGASDAEVGGMSNGGGSHGGG
GEHHDEEEMSEIFIHQGIHTIEYVLGSVSHTASYLRLWALSLAHAQLAEVLWSMVLSLGL
NKEGWLGGIFLTVVFAFWAVLTVGILVLMEGLSAFLHTLRLHWVEFQSKFYMGHGYAFQP
FSFDTIIENGGAVTETE

BLAST