GenomeNet

>tr:A0A0R1XM13_9LACO [A0A0R1XM13] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KRM30813.1};
MDVITKDWSSSKYLKLWLNVSICVPTFLVVETLAAFKWPFMTILTVVLAGSAVMGVLCGI
MGVLGRRTQKNFVTLISDVFGKKFSKFFYVLRGLDCAGWYGINIAAATQLIVNLITVVTG
VKVSNPIFIGIFLVLLVGNAVIAQSSGGLQRLLTITLCVLIPGIVIILFQMGGRVFANAN
FFVNSQGLVFRDVIGNICVVAAYWNGFALNMFDFGRNAKSDKSAFWGNCVGIVLGMGAMT
VIAAIFAIQSFMTTGSYNWNLSHSLLHVSSSVPIHILVVVVFLMFMISTNSVANYYPAIQ
CLKAIMTKSRNSINMAIFLVISSAITPFFLSSSTSQLAYYWINLCGTVLAPLLAVLICYI
ILAKYHTVNADQYKWIYIVWTSAYIGIELVTLSILSYLWIIAIIGIFSTVTILHRLGQHA
QKTNLVDGDL

BLAST