GenomeNet

>tr:A0A0R2LXT9_9LACO [A0A0R2LXT9] SubName: Full=Purine-cytosine permease related protein {ECO:0000313|EMBL:KRO04507.1};
MAQEIKTLVKAPAKTYGRVDAVPRESRRMGNWDLFATWIGANANNGTWYIGGVIAACGFL
TASTTLMVVGVLAYVLLAAASYMGYRTGLPAMALTRTSFGLRGSIVPSIINVVQFIGWAA
VNTFIAATSISYIFGELFGWPLYGKPGGNFGLIVGIIIMSVLHLLSISMGERSVRLIERV
GIILVVVFVLWESVVVFQTVSFHDIVSWQPPHALKMSSGVAADTLAAFNLAWVTAASDFS
RFTNKRSAATTASFLGANIGLFWFALIGLFATIGTAVSLNHFDPNNSDPSTVAAKLGLGV
IALLVIVLTSTTANAVNLMSAGSALTNITHRLSLNVSLWVVTILATAVSFIPVYLASFLD
VFETFLDGIGMFLGPEIAIFLLDYFVLKRRRYHLKEFTAVRGAYWYAHGVNWVAVASWAL
GVAAYWGLKQVSVIADTVGATFIAMALTALIYWIGMSVTTSEAGSEEQVN

BLAST