GenomeNet

>tr:A0A0R3PBN3_ANGCS [A0A0R3PBN3] RecName: Full=RING-type domain-containing protein {ECO:0000259|PROSITE:PS50089};
MANDWIHCNACYRQPAQGIVFFFSSCGHIICQKCASAADRTKLESSCPVCCRKCAFVEIN
RSLRPELQMFFRNPKELATQYMKSLSQVLEFQGSNRSRFIKHIAEKEKKATKFAHLARDE
IKRRIELERHRIYHVKHVILSIEFALPNFSKAVEEHARLKCELDMERMRCRDLEAKLTEN
EKKIEELRKGFCTLQPPVARSDSVIDAEMETDSGLSFMNVATSTPIRSYSPNNRFTSTGH
RNRNHISEMFLASSDDVPSPITFSSDQPMTTPAMLGIKRSTYRGSNSSSRSHGSNKKYNF
QAASVAVRKGF

BLAST