GenomeNet

>tr:A0A0R3PFD5_ANGCS [A0A0R3PFD5] SubName: Full=Uncharacterized protein {ECO:0000313|WBParaSite:ACOC_0000287801-mRNA-1};
MDERVVLNVGGVRHETYQATLKKIPATRLSRLTPSLANFDPLLNEYFFDRHPAVFSQILN
YYRTGKLHYPTDVCGPLFEEELHYWGLDASDTEPCCWMQLLHAKDTQETLAVLDRMDVEK
EDDPQLRELDTMRKFGWEEEYFQGNRTKWMYYKPKIWSLFDEPYSSRSAKIIAGISVWFI
FVSILSFCLKTHPRLRIPIIDASNKTFHGLVIVAVTRQATEPHVMFGQIEFICNIWFTLE
IIVRFIFCPSKIGFLKSPLNNIDLVATLSFYADAIFVRLMDDAPKDVVEFLSMIRIFRLF
KLTQHHRGLQILIHTFRASAKELILLVFFLLLGVVIFAALVYYAEKMEINPDNQFQSIPL
GLWWAICTMTTVGYGDMTPHTSFGRLVGSLCAVMGVLTIALPVPVIVSNFAMFYSHTQAR
DKLPKKRRRVLPVEQVSRNVLKL

BLAST