GenomeNet

>tr:A0A0R3Q2Z1_9BILA [A0A0R3Q2Z1] SubName: Full=LPD22 domain-containing protein {ECO:0000313|WBParaSite:BTMF_0000033201-mRNA-1};
MSVGLGANPDMEAELRKVARRTGVPVDTARAYPEELKRQAAMGQMDFDSLAQQFPRTAGF
LSGTENAKVAHDDVENMGLIETMINSFQRGIPALKSMIPSITTANRSAGLNTFAEIDKRI
AAGEDPKAVLTQYGNYGLAPLPWQSSEQALASWNAFKARAVPLTQQAIAESVSDIVKYQN
ERNKIPLPSVVEKTMGAKTWGEAFSEIGKDPVRFIAAIGPESLVQSGPGLLAAIPAGATM
GPGGAAATIGGNSFLVDYASTILESLNSAGVNTSDAEAVKAAMRDPKILESITDQAVKHA
GVVGAFDALSGGIAGKMVLPQKIAGKLAARPLAQEMANIALQVPIQATLGAAGEAGGELA
AGQELQPGQILAEAFGEFFGTPGEVVSASAKRIRERVSQAQEAKANAAKLQQISDLAEAS
KLRARDPDSFQEFVNQAAENGPIKDVFIDANQLMQTGMAEQIAAVSPAVADQLSTALATG
GDIRIPIAEYAARIAGTEFNQSLMDHLKTEPGGMSRAEADLFMQNYAQELQQSVERTLNE
KQNDQEFKAAADEVKAKIKDQLDQVSRFTEPVNEAYSTMVSNFYAVMGAKLGIPPVELYS
RYPLTVASESLVDANVLDQTAYHGTPHRNIEKFSTDKIGTGEGAQAYGWGLYFASQKDIA
EWYRTKLSKPEQTNNKGQLYSVEIPEDNQMLLWDKPISQQSNEVIKKLNGVKDALTESGV
LDEYLERKNLDWDELTGQDLYHILKRASLDDALPENGPGIANASVNGRDDKAASMFLYNE
GVAGIKYLDGNSRTAQSGSHNYVVFSGDDVEITNQFYQNKGANRGRFSPSTNTITLLKNA
DLSTFLHESGHFFLETMLDVAAQADAPKTIQDDVSAVFKWFGVKDLAEWQSFDFEQKRGF
HEQFARGFEAYLFEGKAPSLGMQGLFQRFRAWLLNVYKDIKSLNVELNDDVRGVFDRMLA
STEEIKLAEQNQSMMPLFKDAQTAGMTPDEFAAYQSLGVDATNNAIQELQAKGLRDMQWL
HNARGREIKRLQKESAAKRAEVESQVTDEVMSQPVYRAWSELKSKEGAKISPDALADMYG
GNGDKYALLDWKRLSDMRMTSKERGIHPDVLAEMMGFDSGDKLVKALLATEDPKVEIEAA
TDLRMLETYGDLYSPDAIERAADRAIHNDARSRFVATEANALAKATGQRKVLAAAARSFA
ETMINRLKVREVKPAQYVAAETRSAKLADEAMRKGDLETAAAEKRNQLVNNYATRAAYEA
QESVDKGLRYLDKFSKESTLKNIDAEYSDQIFALLDRFDLRKGQSLKSIDKRAALADWIN
SQREQGLEPNIPDELVNEAFRKSYKDMTIEEFKGLVDSVKQIEHLGRLKNRLLTAADNRA
YSDIRDSIVTSINDNANGRTADTRTPTTNMGRMTQTLKRFWAAHIKVATWARVMDGGKDG
GPVWEYFVRSANERGDMETTMRAEATEALSKIMAPVFALGKMGGKGQFFESIGRSLNREA
VMTIALNTGNQGNLQRLLGGEGWTTQQIAPVLATLSSVEWRAVQQIWDHFESYRPQISAK
ERRIYGTEPDWVEPTPFSVETSDGETVALRGGYYPIKYDPAASQRAEEHADAEGAKRQLQ
GAYTSATTRRSFTKTRSEEVSGRPLLYTLAGMYSGVNDVIHDLSWHEWLIDVNRLMRSKS
IDTAIRTQYGPEVKAQFKSWINDVAEGEKGAQNAGEVALSRLRQGISASGLGFNVMSAVM
QPLGITQSIVRVGAPWIGKGIAKYIAAPIDTTREVNSKSAFMENRARTRFRELNELRNKV
QGETAVSEAIKSGAYMLMMRCQQMVDTPTWIGAYEKAIAGGNEEARAIALADQAVIDAQG
GGQTKDLAAIERGGPAMKLFTVFYSFMNTALNIGVAQTMTAQSKAKLAADYLMLYVAPPV
LGYFLKAALTPGAGDEMEDPEKLAKALAAQQLDYMMGLMVVAREFAEAAKIVTGLEDKGR
DYGGPAGLRLISDTGSFAKQAQQGEFDDAFRKASVNLVGDMFGLPSAQINRTITGAQAMS
EGKTENPTALVFGYQAKK

BLAST