GenomeNet

>tr:A0A0R3TCL2_HYMNN [A0A0R3TCL2] SubName: Full=Uncharacterized protein {ECO:0000313|WBParaSite:HNAJ_0000480101-mRNA-1};
MASRSATYEYCPRAEPIEGLEYPLTVNYCGECTMPIEYCEFSSDPAKCKAWLEKNLPQLF
EQISTGTEENVGDGGAKKKSRQSRGGKGPGSKKPTEQKVTVSRSSRGKNKFTTSVIGLDT
YGIDLKTAAKFFGQKFATGSSANNTGEIVIQGDVKYELMDIIPQKWDQIPEGSIIDLGEI
KR

BLAST