GenomeNet

>tr:A0A0R4IH08_DANRE [A0A0R4IH08] SubName: Full=Inositol 1,4,5-trisphosphate receptor, type 3 {ECO:0000313|Ensembl:ENSDARP00000133340};
MSDSASSFLHIGDIVSLYAEGTVNGFISTLGLVDDRCVVEPASGDLENPPKKFRDCLFKV
YPMNRYSAQKQFWKAKQAKHEKDKIGDMVLLQKLQHAANLEQKQNDAENKKVHGDVVKYG
SVIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDGTGNEGSWLFIQPFWKLRANGDNVVV
GDKVILNPVNAGQPLHASSYELPDHSGCKEINSVNSNTSWKISLFMMFSDHKDEVLKGGD
VVRLFHAEQEKFLTCDEYKSKLHVFLRTTLRQSATSATSSNALWEVEVVHHDPCRGGAGH
WNSLYRFKHLATGNYLAAEENPGYKENSNDIEVDSSRIKRSLGERIKYKLVAVPHGNDIA
SLFELDPTTLQKTDSFVPRNSYVRFRHLCTNTWIQSTNIPIDIDEERPIRLMLGTCPTKE
DKEAFAIVSVPVMEIRDLDFANDASLMLSTVVEKFKYGFLSPNDRRYAIKLLEDVVFFVV
DQLNNGQPALEVSMNKPNRERQKLMREQNILKQIFGIIKAPFKERGDDPPLLTLEELSDQ
KYLLYQYMLRLCYRVLRHSQEDYRKNQEYIAKQFGMMQSQIGYDILAEDTITALLHNNRK
LLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNNVAIPVTQELICKCVLNAKNQDI
LMKTERRAAKESQHTSEYLEEFGDEDEVWLIWSEKENENHEKSIRQLAQEARQGNVHDEN
VLTYYRYQLKLFARMCFDRQYLAIDVISKQLDIELISLCMMDETLPFDLRASFCRLMLHA
HVDRDPQELVTPIKFARLWTEIPTSISIKDYDSHLDYSRDNKKNKFANTMAFMEEYLNNV
LIDDLPFANEEKNKLTYEVVSLARHLIYFGFYSFFELLRLTRTLLGIIDCTPSNASINPL
FNDDGSGKNVRRSIHGMGQMMSTMVLNRKPSLFSAPGRTGDSQVGSKDSIDTQDITVMDT
KLKILEILQFILSVRLDYRLSFLLSVFKKEFVDVYPMEDADATHHTEHEASINLQHIGEQ
AEAMFGIGKGNSILEVDDEGGRMFLRVLIHLIMHDYPPLVSGALQLLFKHFSQRQEVLHT
FKQVQLLISTQDVDNYKHIKRDLDLLRTMVEKSELWVIKKSSSGGDGKKDKKDKKEPEAV
SPEEEADSKKQTTEKSNESYQNVKEILERLNKMCSSGVFKKQQRLLKNMGAHKVMLDLLQ
ISYDRNDTKMLEIIKYTHLFLQKFCTGNLENQALLHKHLNLFLTPRLLEAETMQQIFSNN
FQLCSEISESVLHHFIHCLATQGRHIQYLNFLHTIIKAEGKYVKKCQDMIMTELTSAGDD
VVVLYTDDTSFNTMVELMTQSREGVKDDSPLRYHISLVELLAACAEGKNVYTEIKCTSLL
PLEEMVKVITHEDCITEVKIAYVNFVNHCYVDTEVEMKEIYTSNHIWKLFENFTVDMARV
CSNREKRMSDPVLEKYVIQVVLDTVTAFFSSPFSENSTSTEAHHTTVKQLLQSTMRLLDC
PWLQPQQKVQVESCIRTLAVTTKSRSIPLPVELEAHVNMMLSHSNSLTLSRSSHSNKSMS
RLTRPAAPTNPWDYKNIIEKLQDIINTLEERVMPLVNAELSVLVDVLHQPELLFLEGTDA
RSRCESGGFISKLIQHTKALMNSDEKLCIKVLRTLQEMLIRELDFDEKGFALRKVLLQNY
LYNNKKNIKAELVEHAGGAEGERDWLTVAALQCRLDKEGGTKLFTDLITSTKNEKIFQES
IQLAICLLEGGNTEIQNSFYKLMMGDNKSEKFFKVLNDRMKNAQLDIKSTVSVNVGEMSN
KAKDDKDLETGGVSSFGQPEPQPEQQEVETEMGPSVTIMKPILRFLQLLCENHNQDLQNF
LRIQNNKTNYNLVSETLQFLDIMCGSTTGGLGLLGLYINENNVELITQTLETLTEYCQGP
CQENQTCIVSHECNGIDIITALILNDISPLCRYRMELVLQLKDNASKLLLALMESRHDSE
NAERILFNLRPRELVELIKKAYLQEGECKEGEVSPREVGHNIYILALQLARHNKVLLTLL
KPVKKIKEEEEESISSMLNLNKQQEEEKEDPLEHYDRQTAQIEIVREDRSMEQIVFPVHP
ICEFLTEESKFRVFTTTEQDEQGSKVTNFFEQTSFLHNEMEWQKKLRSMPVLYWFSRRMS
LWGTISFNLAVFINLIIALFYPHDSGHSGSIDSSLLLMGFWCFAGLAVLGLLFKRYGFQS
LTVAITLRCIYHFGIGPTLLLLGALNLINKIVYLVSFVGNNGTFIMGYKAMVMDVEFLYH
VAYVLTSSLGLFVHEFFYSILLFDLIYREETLFNVIKSVTRNGRSILLTAVLAIILVYLF
SIVGFLFLRNDFIMEVDHLASPAPGDTESFMSSCSSDGIDCTEETGLLAPAEDEDNTERA
CDTLLMCIITVLNHGLRNGGGVGDVLRKPSKNEPLFPARVVYDLLFYFIVIIIVLNLIFG
VIIDTFADLRSEKQKKEEVLKTTCFICGLERDKFDNKTVSFEEHIKLEHNIWNYLYFIVL
IREKNKTDYTGPESYVALMIKNKNLDWFPRMQAMSLVVTDGDGEQNEMRNLQDRLSSTMK
VVTQLTSQLTELKEQMTEQRKRRQRMGFVDVQSGSNPGMPVPPSPAGGNQVYKA

BLAST