GenomeNet

>tr:A0A0S4JQF2_BODSA [A0A0S4JQF2] SubName: Full=Transmembrane protein, putative {ECO:0000313|EMBL:CUG92420.1};
MPRNTLRYGHKVMLRVPSLNGVLTSTNSAITPLGIRPHAKDDVLSLEDSIFMLIPGDGEF
NAKDDIDVREEVKFGHVVRLVHCTQRCPVVHLSNEPAVLDKAAQRVTIDDPARFNSLDPS
AALYRTERFRVLPKYKVRGEGERVCEGDHILLQSALSSATFISTSDQKDDRTDGCFEVQC
TNEGSCFVVDFYDAEEIKEKSATIRGGQCVTLVHRETSRLFAATHLENSTTDDLMRAIVL
DEPLQQNAADPLSIKGITYENLFIIEFEDRGRSGAVQVISREHYRIKSLAAGGYLAVDAA
KNRLFFTNDISNPGALFTFHAASDDREQTLQSGGRIFLEATIAGGENQWVSLRNEVLEVN
GVELPYLALETCAEESVSDGVEVQLLPFIEYRDLSRVMSLLPPLKKFTASIQESSIDNTT
VAQVRANVRQLRRFCYQVAGESHIDVANEVDGVLDNKGQGRLLHQGVPQLLMSLVRAILS
SPLFDRTMLFSAEDVASLKPKGQSTNDDPSTPIRYSDIIGVVDDCLSVIQLVVRDNYRAS
IALRSLLPSLMAACEDIPAAVGCVAEFLRGNSALLEELSEEGCKDLLRFMDLLVLRPRDA
VLMQLVGLFASHRDVGFPEAQRVIKERLIDDAALRDSLFFQYSRDALGIIYVEIPEAYLA
PKHIRELKAPSRVINGEKVFSVKLSDLPDIASQTRMVGRPNVIPLVAGQLELLSAVCAGR
KATSIQTLSTIIDVDILMDSMDKIAVPPIIHSGLINLFSSGVVIDSECTNLEDVLESMRY
VVDDPAAPDPFVFEVDVTDSYLVRACTFAKKFLTSGDGIMTSDEGKREELDAVVRLTKAL
LSRRCWSLSDYTPIIHSLISFLDRRNDEASNDPEVFRDKVMIVQTLDAFVDVLLGVKAAR
ITREFVKNPNEPLFPPMCQFISLEPFSDLSEQFEGRRNALLSSKHQFVSQFQHLRATHVA
PEALHTTLLHALDVLQDIASIHNWDLRRESIRFYCRLTHCWESLSLMLENVTVSTSANTE
VFNITKSAFDALHHYLSIKRSSHKAAAAIQRLIELLQSRKDVLPKPGETTMADVLGMFQQ
MKVVDTILTIMGELENINKVRTSESGLTELCLRGLQFLELICSIDDFSRQKIGEEMDKLV
FSAVAAPAPFMSVCRTVFVDGKGVFGLSSLAVFEVVQIVGLGGAMGDTAIALLHDILAVK
DIAGRYVSKNQQMVWRAILNHKVVAKMIHIHDTWTGKRGVEIRDAKLQGPHAKSEIDTHI
AFLDVIYLVAKQNDLVKPEEIRYELFGPNGVDDLMEVVSNLDLAATFRYTYINLLQVLVI
EDLGGLAAIFNHRMLKDFLAACRYDIHCGATLLDDQNQQSTNSASPQLQIEGSQSKIQRP
TFSIFSDRDQAQAFMGDYLCMAVFPCVRHLMERLSDTARRLHPKVRTTLTKKKAINSESI
SNKWQLFLQSQFQPLLSSNRVMAGSAGVLLRNPILGTAFMKTLVTSLPFLEETVACRVLH
LMRQVIELQENDPDDCSVMLPFGHVEGLHDKRTLTMLKTKEHRQNIAATFDPSRPSQQML
PLVSDLISRSNPRVRDAALHTAIAILDGGNRPMQQTMYDSIVERCDEQIFLHLRDIFSST
RETLVTYVKILKRAADPRDTVDNLGNVTKLLRYTQLLCEGHFRENQEYLRVQPLNVVSVN
VIEAMCDALDMVSRCIDFRTVSFATQLVVTLIEVLQGPCRMNQDFCVSAGVAERLVTILT
LSVEKDDHDGKQREGLSGVDPEVLLNMQLKSMDGLLALIEGRTEKAYLATLVSSISLKTL
CNSMDRSVAAYEKDHGSIADDDGITLGSAWRRFKSYMVPEDVEDELNDDLSLAVNVFIFI
RSCLDHQNLLSQNDDSVEFVDAEGYTIKRVLRKTESFHTVNKKVGMVEILREGSIERSYF
RILSSSSTNLLKKQKQSLIKDVERDSDNRRLQSFLELSAGLIEEIEFYSGLRRIPLVSLF
QDFDYVLDYFSLLWALIVNIAMMVVVNAPMNSFDSELSPKDSRIINGLAIVQIVLQSMMM
VNYMIGPMRVNYASKMRKYLSEQIQDAVDEARINLSVEDADVSEYKMDNLSLFERSLHAV
YHTCMHGVFLQRVLFLVAAILGLTQSKIWHTIQLLHITNKSSILSNVLLAVTTNGVSLIL
TSVLMVIVIYIYGAISFYNFTEFFDPNKSGRGYDCQSLVSCWFVHIDAIRNGGGIGDSTS
NPYFDDYNTIGFYYAFFRLVYYITVIVIFLNIVFGIIVDSFAQLREEREGVVTDQQSKCF
ICGIEQNAFDLITPGGFEQHITSEHNMWHYVYFMHYLQVKDEDEFNGQEADVAKKLESRD
TSFFPVGQSMATNSAAVPAVDVEEKLAHLTATVDTINARCNALEDQLHAFTETVISELRS
MKAALVPSRDKR

BLAST