GenomeNet

>tr:A0A0S4KCP3_9BURK [A0A0S4KCP3] SubName: Full=NADP-dependent malic enzyme {ECO:0000313|EMBL:CUU33314.1}; EC=1.1.1.40 {ECO:0000313|EMBL:CUU33314.1};
MDSSPEKKEELRQQLRLAALEYHECPRPGKISVTPTKQLLNQRDLALAYSPGVAAPCEEI
VKDPGNAYKYTARGNLVAVITNGTAVLGLGNIGPLASKPVMEGKGVLFKKFAGIDVFDIE
INEQDPDKLVDIIASLEPTFGGINLEDIKAPECFYIERQLRDRMKIPVFHDDQHGTAIIV
GAAILNGVKVVGKDIRECKLVVSGAGAAALACLELIVDLGFPIENIYVTDLAGVVYKGRT
ELMDPDKARFAQDTPLRTLAEVMPGADIFLGLSAGGVLKQDMVKGMAANPLILALANPTP
EILPEDVKAVRGDAIIATGRSDYPNQVNNVLCFPYIFRGALDCGATTITREMEIAVVHAI
ADLAHAEQSDVVATTYGISNLSFGPEYLIPMPFDPRLLIHIAPAVAKAAFESGVATRPIA
NLEAYADSLQQFVYRSGTFMKPLFAVAKAAPPELKRIVYAEGEEERVLRAVQVVVDEKLA
RPILVGRPSVLEQRIEKFGLRLKQGEHFDVINPDHEDRYRDYWQTYYAMTMRKGVTQEYA
KLEMRRRHSLIGAMMIHKGDADGMICGTFGTTNLHLHYIDQVLGKREGANVYAAMNFLIL
PERQMAIVDTHVNEDPSAEQLAEITIMAADEMSRFGLIPRAALLSHSNFGSANSASAQKM
RAALALVQQKAPQLEIDGEMHGDVALDAKLRKQLMPHSTLQGEANLLVMPNIDSANIAYN
LLKTAAGNGIAIGPVLLGCAKPVHILTPSATVRRIVNMTALCVVDAVSER

BLAST