GenomeNet

>tr:A0A0S7DRX5_9EURO [A0A0S7DRX5] SubName: Full=RING finger protein ETP1 homolog {ECO:0000313|EMBL:GAQ08189.1};
MPSYFYHLAIELFARPQSGLGFASQSADHRSPTSLSFDSACEALLPFQKRARQSISTIYN
SHQSRTTSSQSASATAQTHPTVPHRYTKSPTSASDCENDLRLDKISIECVDMVPSEHESA
TASKRIGKRDVKDNPVATGIGTDILGGLRTKGKYIPLDQQTPESIWGIVHLYRDAEETPF
LVGEDYPLELKGSAAAARQPYDQLGARQDAPAKGHSPSLRGDEDCTTLCILAVPSYMSPS
DFLGFVGEATMDEVSHFRMIRTARANRYMVLMKFRSGKKAKEWQKEWNGKVFNSMEPETC
HVVFVKTVEIQAVNSDSDVSASQQSAPSASHVATSPQRTAISTSVQPSSIPAATLSSKPL
APPTPALIELPTCPVCLERMDETTGLLTILCQHVFHCTCLQKWKGSGCPVCRYTQDDFRR
GSQGAAYGDEPAECSVCRSEINLWICLICGNVGCGRYDGAHAFAHYKETSHAFAMDLASQ
RVWSYVGDAYVHRIIQSKTDGKLVELPAADNSALDPPDWTDAVPREKLENMSVEYTHLLT
SQLESQRAYFEEVVERAADKASQATAAASMAQETAEKAAASLRALQAQYDKLAAETLPGL
ERDKARAEKRAEKFEAMTRTMEKEWREEKTMNESLMKRIEHLTAEVAELKAANADLTEQN
RDLTFFISGSERLKDQGEDVVQGTVSVPDPPANSKRKGRGKGKK

BLAST