GenomeNet

>tr:A0A0S8DGE5_9PROT [A0A0S8DGE5] SubName: Full=Deoxyadenosine kinase {ECO:0000313|EMBL:KPK35327.1};
MTLPEHYRYVVVEGPIGAGKTSLARRLAQHLGGELLLEAPDENPFLPKFYEEPARHALAT
QLFFLFQRIQQLRDLKQIDLFGGVTVSDFLFDKDALFARLNLADEELHLYQQIYGQLAPQ
APVPDLVIYLQASQERLVERVKRRDKSYERSIDERYLSRLADEYRRFFYQFDAAPLLIVN
SDKLNFVDEEADFDLLLRRIGEMKGPRAFFSKGD

BLAST