GenomeNet

>tr:A0A0U1KXI5_9FIRM [A0A0U1KXI5] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:CQR71384.1};
MALDPEQEQLLIDKYSTTNPLGQVMQVAKNLPQDQAAKILKYSLASGDAPILVANNLHAY
ETDIVDQIDWDNVLQQSPKTYEFLNNPLHMAAVRDQQNVATLSNLENSWLSWHDLKEGGK
GVMQAAAGFGQGVMDFGAALRQNADDTFAASHTPEEVAARNNEFGRQAMGAAGQGISNLF
GNIADYFAPDKPKRYASKAQEYTHAVLQQAPQLAAQIALAYFTGGVGATAFMGSQIAGSE
YLKLRGEGIEPARAFGASMGDAALQAPLESIGLNKIMKKLPAGKLKVREIMESGLTEGIT
EWIQQYPESAAEIWARHPEYTPEQRGAQFMQDFAETTQEGIYQGLVAAPFGFLGGAVKVA
MEKKQAEAYVQNIDQLVDMVSDSPLLKISPETIEKHLDEVTEGENVCVDPEAMVLFQSEN
PRLAEELGVSETETQEALATGAMVEIPVGKYVTVAATHPEVQDALKEFISGDEEGITMHR
VNEQRNTKDIAEASKEVEQQQNEVRQESDKIFQSWTDAGMPKNVARDALTLLVSNAYTQS
DNPVQFLRDKAPQVRRQKQGSVPGALHQYAGTQALTADRLNLQEAQKLEAAGEDVGAAGS
IRQKTGWHKGQDNKWRFEIDDSKAKMVDWSGLKDMEEQATKLYRQANKAKDPAKAAELRA
KGDEVLAEYTSKQPTKLSRVLDHPALYAAYPAIANTKIVFSDLPKGNQGAYRPAINTIEL
NKNLTADEMKETLLHEVQHVIQSYEQFAPGGNPTMFDDIDQTDNELERLQGELDSIINEH
PESRTQIERAWELEAKPEEERTDAEENELDTIYDSVYNGTGEWGKRLAQKEDELKQMAET
GSVLTAFSQYQRLHGEIEARDTARRANMTADERQAIPPETRADAIILYRGREFAYSPGAK
DSQDINYFQNEGNPKGSIHWGDDGRAIITLMEGADASTVIHELVGHYFTQNLLDQGALDT
APEWMKKDRKTVLEYVGIENWETATREEKTAAHEKMAEAAETYILEGKSPSQALASVFQR
FAEWLTAVYQQIRRADLDLKPEIREVFDRMLASQDEIAHMELIKDYHRRMPQEILSTLSE
KQIAWLDKSLDKVREKSKDILRGRVLKRFTAEQKAEIKAEMERVRPEIEEETAKEPIYLA
MEELRKQSGGGNPRNVANEYVRGLTNASQNILFNIIADQYGFTSADHMMKKISDSKDWKN
EVKARIDQHIQNTFGDIYERKNLLRQEAEQAMFNEEGATLLAIEDQILQEKLGKVITREE
QRREVIRQRDAAKTLAAESIAKVSLDRAMRVTTYIAAERRAAERGKAAWIKGDYVAAQKE
KEIQLHNHAMVMASLNARREFERINRYLKRQRTVDKLTWVSETDWFQAADLLRRFGFVRK
DYDPSKKMESLGQYITRQKTENPDMIRIADWLATYEDQVYNSRTLSLNEYRDVENALRNI
KKIAKAGVNSDGFVQISDKPVGEVAATLYNLADVNVKNVQTDKIERENRPPGYMTGLKKI
SQQLLKLDGYKDFGLWDHTFSNRHMRPKTIKANCATRCWIRLRKPGQLNILRRSGRIMRI
RIKLYILKNGMTRLLKTPY

BLAST