GenomeNet

>tr:A0A0V1HV04_9BILA [A0A0V1HV04] SubName: Full=Ryanodine receptor 44F {ECO:0000313|EMBL:KRZ14377.1};
MTDFQENSTGEQDDISFLRTGDVVCLTCLAPCKESGTGSAERVSLAAEGFGNRICYLENV
SDKNKPPDNATSMFYIDQALSVRALQEMMSSESPNISGSSSTHRTLLYGHAVQLKHTLSG
MYLTCLSTSSASDKLAFDVGLCETNVGESCWWTIHPASKQRSEGEKVRFGDDVILVSVAT
ERYLHMSSTNGNTVLAAFHQTLWSITPNSSGGVRERHMGYVCGNDVLRLNHGNDECLTIP
ENWSDSPQNNIVIYENGKSCNQARSLWRPELIHGKWQSSLIGWEQAFRIRHITSGRFLAL
NEDNQDVKRSTFEEKEEEGMGVATVKYGETVIFLQHLQSNLWLSCQLELLTFLKSSSNTK
FEDEIVDLLCIFKTTAVTKKNMGKVEEKKAIAVEEARMDDCFILFKAQEEESQSARVIRK
CSQILNRFLRGLEGLQMEGRDSLAWNRADLSETVKLMEDLIQYFAQPEENVDFESMQNGL
RALRNRQDLFQEEGLLNMIIDTIDQFSVVESMTELLDVTKEDKCKDWQDISTYLYLLVAA
MIKGNHSNCTQFASAQRLNWLFSRLSNPQSAEGILDVLYCILTESPEALNMINEDHVKAV
ISLLEKVGHDPKVLNVLSALCEGNGVAVRNSQNVICSELLCNKKFLLQTKMIDQVSSVMA
NIFVGSYENSAMYPRWYFEAELEYMESMHTSGQKPHLRIGWASSAGYRAYPGSGKKWGCN
GVGDDMFSFGFDGQYIYAGIAALKLSKLIGGIEKFVGTHEFRKGDVIGCSLDLAVPEIQF
SLNGHQIGTSVRNFSSCDCLFFPVMSLSAIVSCRFFFGGSQGKLRFGPKKGYLPISEAAI
TPVKLISCISFGDNRKGYFAGPSTVISDYIVFQPKPIDTKDRRSETQKTHPCLTSYERLP
TAERSYNLNLAKETLKTIVALGYRIDLGKASNRVKTFRLGQNFLMSNGYKPAPLDTREYE
LNETLETLVDQLAKNMHNIWAQSKIQRGWTYSNNEVRNVNIKTTSHLVAYDFLDPNIKAA
NRDKAGQIIRSLLVYNYCIEPPTAEQDEGAVKQAQVMNLQKRTYRFEKSYAVKSGKWYFE
FEVRTSGFMNVGWMDVSASPDSDFGLHKSSYAYDGYLGRKWRGESESYGKKWNVGDVVGC
FLDLTDRTICFSLNGELLLDSSGTEVAFDNVSAEDGFVPAFSLAPGQIGRLNCGQNVNTL
KYYTTCGLQEGYEPFCIRMSRQAPMWIAKCEAEFDEINEKEKRFKVTRIPQSGDNPPCLK
LQCKSAGMLERCSLALFRLNLPVFCKEANDNRVCNQYFTETLSERNAGKRNCETDRTAES
GRRGKMKGVRGSRNQDEDISFHDQQNYAEQYEVSNHAVMKSNYLVQKTFSLDDDSSEVTE
NRFRKAPRLRSSASEANLKEKESIDSQDKISASYAVSNTKRNLRPFKVLLVNIMKLLLIK
REFLDARKLQEACASKSKIRSDENDKFLSGRLSSRKLDDRVADVDSTESLDMPKSGPGRR
PTVIRLESDSKVKKRSNYFSSGHDLLVEASKLSAPSGNQHVSIGTSVSFYSTPDDYYFGI
RVFPGQDLANIWIGWLTPQFSFIGSQIAADSQRICFLESTHGTLDNIQEFRSCYIVNGME
LLTAAGGSSNVSKMAGLLAGCLINTATGELKFHVNGKQTEMSYRVEPGTILYPAVFVLPT
SREVLQFELGNIEKTLPIASAQLNERSNAVQLMCPPRLKIEICKTRTWLRVPDQCARVTS
LKLSDTRGWSVLCDDLVRTMMLYVPERDSSIDILELVEHESLCTFHQQTLRLYCSLCAQG
NFKIAHILCQHVDEDQLMYAIQSKYLSGSLRRCFYDVLIAIHLKCHYDARLAESHEYIIP
LNAKLKDRNYFNYETKSVYPHALNSDITLKSSINVMEVKKKISTEDEKFLMSPTFDFHTL
KQYVVDALEEATLEALMNSRDLIGGTNTTHFLPILKLFDTLLLVGVLSDTDIHRFFRLLN
PRSFQETLDSPQNVKGLVDLDLDEMVQLELCHIMNHLCDLQLQGRVESLINFAETFVGET
QNDQLRRYLEIKQTDMPSAEAARKTKEFRCPPKEQMLKLLDFKADRDEQTDEEGELEVSA
MSEFLQRVLREFHCNMVKCIGNSDKNDDNYSANVEQKQLESENMNWVEKLAWMVVPVPPA
LLSEDERIKFDGEEAFRNIILSTLIKWTGNKAIDDPNLIREIFGLLLRQYTRISEVKSAL
KTAYCIHERSTEDVQSFLDNLCQIRRLLCVQFEATEEEVLKNSLWDMMNNKVFFQHPDLM
RLLKVHENVMTIMVNVLSRAQKSELDDRRNRSTQDDIKKAFQSSISDLVVACCKFLCFIC
RSSTKNQAAMFEHLPFLLDNATMLLAKPSLRGSVPLDVAYYSFMENSELALALKEDDLEK
VAFYLSRCGLQANAEMVFKGYPDIGWDPVEGERYVDFLRFCVWVNGECVEENANLVIRLL
IRRPECLGPALKGQGEGLFRAFKDAISLSSEISNLHKGRDLRSRFNFDLSHYPNPEIEEE
DYIDLGAAILGFYSSLADLLGKCAPDHLTVKSGKGESVRLRSILRSLTSVEDLEAILALR
FLLPNVFAAKEESVRSSCIGLLPCHKQSILLFLERVYGLIDKEMVFRLLEQSFILDFRAA
TILDHPAYAESDLALALNRYLCGSVLPLLTSHAHCFADAEHYYSLLEATLHTVYRMSKIK
SLTKSQRSAITEFLLAFTKEIHPGMMKKLLQKVVVDISSLNEFATVPLQIMTQHYECFSK
HYGISLHEDMASEEQKRLSMLLFTTIFDSLGKRAFDSDLFASALPCLTAIGSALSPDYAM
QSYAEEDIQNMNVSSDHMEVWRPHPVDASNVQLSVNLQNLVQRFAQHFHDSWASRKLEKG
WRNDDIYSRTNCTHPRLKPFGMLKEFEQNFYKERCSECLKALLAWGYSIDQETQVSSVQP
KSMNPTSNVRSASVFCPQPIDLSNMTLSEEMCELAERMAENSHLIWVSKTIEDLNDANTG
IMVLLVPWDILADSEKRKHRFRAQEVLKFLQYQGFRLKSPLHRDKEEHQQTVVDSNTHRP
VEKRFACNLLEKLLAYLENAAQKMDVIKPSKQFSRYRNYTLPSEDVKFFGKVLLPLLESY
FRSHRNYFTAASSASLSGVASIKEKEMVAGLFHRLMSVFRTKHNAFGCHVKSTVRCLQVL
LQAIDFRSLVKINSDTLRTCAQIFLTNMVSDLMNITKEIKNNGRYAEIKGKTLPCTSSLL
FLYEAMLPLLTTLFCHLSKHGHGQDFLVNDIQVGCYKIADCLYMLAAPITISRKSVKEEM
EKHRSSIGQCLSAFACCFPVAFLEADFNANSRCSTVDRQHLLSESKDASSSLLLNIPSLD
NLLSNIEQLSNTNGKYQDAPAIFDVDIPMLCSYMSFWWQHGPTNNTQEKKLSAVSSDHIN
RLFSACSRLICDHIGIAHADWICHLAPFITPMINYVTIEPVRDYLLPMAEKVRMQADLAF
KEEEKHRMHPDVFDESTVIELHSILIRDVYALYPILIKFTDLHRARWLKNPCWETNALFE
HVAFVFKLWITSQHMKREELNFITQFESDFMTGTSRKTGKAAVAFRKKKRREGKRREKDS
GSIVIACLKRLLPVGLSVFGGRELDLLQKVKEKYMKKENDERIKEYIFSSLAVPDQEDVF
DKSHWQRKLYQQIGKAQMLGIDSMSQEMVVDKIIFMGVTLCNLHNVEHPQTFQADAWRKI
VSSQRKRAVVACFRMVALYSIPKHRCVNLFLSGYIEKWLKSEKVDEDLLISDVTVASEGR
IQRLREDVEEVDEQCPPDPLSQLVQCFQRAATSERKQLVPIVDDNLYIKYVRVMASSIHI
NEEEENNTEDDAISMEAQELEKQQLLHEQSRLADRGVAVMVLMYLSACNGEPNVMVEKTL
ALGIHILNGGNSEVQNIMLNYLQEKKDVRFFSSISGLMNRCSVLNLEIFERQLKAEGLGM
GAELSVGKHQNLNDSEFICSLFRFIQLTCEGHNSEFQNYLRNQPGNTTSINLIICTVDYL
LRLQESIMDFYWHFSSKEIVDEAGKAHFLKALSVCSQVFNTLTESIQGPCVGNQMALANS
RLWDAINGFFFLFAHMMDKLSKNHTQLELLREFLSLQKDMIVLMLSMLEGNILNGSIGKQ
MVDTLAESQQNVQLILKFFDMFLKLKDLTTSQAFQEFDTNKDGWISPKEFLRAMEAQKMY
STEEINYLMMCTDVNNDGKIDYMEFTERFHNPAKDIGFNLAILLTNLKEHITGDSRLDQI
LQTASSMCEYFDPYLGRIEIMGSNKRVEKVYFEIKEEWLEQFNKPQIKQSKKDFLFNVLQ
DDGGEQGKLEAFVNFCEDTIFEMSHAAEISSEDRDSRIERAKKQREIFTGMTDKTDTISM
FDIILKIMKKMGASIVSFCRYLRPSELRKLKHSAVSHFSSMTYGQLMLIFLKIVFFIFVT
IFRGAFYLMNTFFRFILLMMYGVREEEKASSKLTAENAVHHTLPKDFNIAPQLYEPEKQE
VYEAFGIQLTQGIGEGLCLKSPSNHPQLEKSFSLHIGNSPPYSIGPVESASVQNERQLMI
YSNQIPESYTPAAVNVCNDDSNIVAKEIYEPKIAETTSSAKGSAFNFLARNFYLLKYITL
ALAFCINAILLFYRVADNTSNDEKVVLEATNSKLQNDEHMENVIEEELAIHDNYYYLAHM
LIFLSVAHCAASLALLIAYYQLKVPLIIFKREKLVARKLEFEGMWITEMPSEDAVSGKWD
SMIISSPSFPEKYWDKFVKKKVKDKYKDQFDEEELNRLLGLDKTVVDGSNSSSSGVDWCY
QIWKLGVIFTDGSFQYLLMYLFFSAVGIWNPFFYAGHLIDVVISFPMLQTILKSVTHNGK
QLILTVMMVLVVVYLYTVLAFNFFRKFYVQDDDGEETDSKCNNMISCFVFNVYAGIRAGG
GIGDELQSPYGDEREAWRILFDMTFHFFIIIILLAIMQGLIIDAFGDLRDQQESAQDKLE
SNCFICDIGKDFFERLPHGFDHHTTKEHNLAYYLFFLMHLINKDDTEYTGQETYVWELYE
KRCWDFFPVGECFLKQYEEQLMAA

BLAST