GenomeNet

>tr:A0A0V1LAK0_9BILA [A0A0V1LAK0] SubName: Full=Inositol 1,4,5-trisphosphate receptor itr-1 {ECO:0000313|EMBL:KRZ56375.1};
MSAVDVFSSTFLHIGDEVSLYAEGSDGTNGFLSTLGLVDDRCVVRPAFGTPENPPKKFRD
CIFKICPVRRYAAQKQLWAEERTRQTNGMSSMTLDMMMRLKFNFRVEDAAEKEREQNQLE
FEKTVGQIVQYGTTLQLLHVKSNKFLTVNKKEPARVDRNAMKVTLDAQGNDGSWFTVEPF
YKLRSLGDNVVAGDRICLVPYYVAQIPGSQKHQLHVSSLSLAEDSESKEVNCLNDQTCWQ
VLLFLEYRENLPDVLKGGDVVRLFHAEQQKFLTQDSRNGVQTVFLRVTKRDQALEATSSK
ALWEVEVIQQEPHKSGAAKWSSTFRFKHLATDMYLAVLEDEQSKKKPFPMSKEFKKKSSK
SSSMEPTYSLVSVIPASPRDPATLFQLDPTTLTKMDAYIPRQSYIRLKHVQTKNWVHSTT
TRCDPEKGDESVMLKLGCSNWKEDKEAFAILSVMPGEVRDLDFANDACKALADFLQRIRH
GLNVMKEKGMIMELLAELIYFVTNAKNHLEDPLKIKPNKVNRNRQKLLREQKVLAQIFDL
LRAPFESRKDQRPLFENPSVLSKPGNESFKRMFQLMYTVLRFSQQSYRRNQVYIAERFID
IQHQIGHGLMAEDTITAVLHDNAKLLETHVEKTHIEKFIELVRQNREGRFLDYLTLLCVC
KNEANKKIQELICLLVLNDANRDILLETRMFGDQVFIGWLNDESEELEKLAYETMNSPEA
ERIVNYYKHQLDLFSHMCLDRQFLAIDPPANKHLLNLSQELPISVILRCMVNERLPYDLR
ANFARLMLHLHVITDLQEVMPVRYARLWKEIPETVSVEKYTNEEIYSFNQKQRRLFARSR
FTGLLTYVEEYLRHVKTAKFSHKAQNVFTLEIVNLAHALVKFGFYSLPELLVLAQDLLDI
LDNCSLDMERVSNGAVVGAVVPNRTEENMKMEVSSFIESEKQPSDHEDGKTVNLKTKLTI
VEILQYVLNVRLDYRITYLLSLIKKEYASSDTGDVGFYEDLDDLKITQFAHEVFYSKSHC
VEVDVEKEDFNCRLELGRENGKQLLRILLQIMLSDYPPLISLGLSVFYQSFNQRNELVQA
LKQLQLLVSQMDVQNYQQVHRDLVLMKNLVEKSELWVYSAKTGSQKRSLFPITNDKKSTE
DEPLQRYDNDLVELINVEEEKKNMMKLFKELNCKYPMSSEHCRKLLSDILNNWVKLCYAD
ERRPDGRNQQLLRNMRVYEVVIEFLSIPFDKKIDSEMPKLFDLAHQFLCGFCNDNEENQR
LLHQRLSLNTDASKCDYLAIEEPRDIETLCAIFRGNRELCANVSDQLIQHVVHLIESKGR
NAIFLQFLQTLIPEERTISLTQEKISQVISTSSEDVCLFYTDSAGFEAMMSLMKQSVDLS
DLCNPLRYHIELVRLLALCTVGKNVTTELQCASHIPLEHIVRVITDEQCFYEIKEVYLQF
LLHCYIDTDADMKDMYCDDCMAQILANVLDDVEQVLLLLLYERGPSINGSVERYICLTVT
KLLICFFEQPCAQCFSDPKHENGIFGRLLEALGRLQSIDWLRRQNAIYKSNLINCVETMC
KFAIIYLFSFPCFYWIGAHDQRLAVTVDMIIRKEGKSSKWTKLKKAKYFVTQAAHMTRKG
HDFNNIVDCFHEIVCRMEDLFGPMARAETMVAVDVLHYPDLTFYDTQSNMKRYSDGEFVT
KLIKHCRLLAYDKNEQLCIKLLDTIRSMIPAEQDLDTSTMNSRKDLLLQYLGIHGPGRSG
KAKSFKDDDQERWTTMLKKILPQNITSVQCSLNAAGASKLVIDLIVHCSSENIFIAAVEL
GKTLLEGGNRVVQNSFLECLTSGGVGENFFRVFNEKMQRAQNKLRSSILSRRDRIGGSRM
TSRSFMSGSSQTSAVGQAHDEAIRKIQDQLKLWSDDDWVGGSESSDIRTERCWREQDKVD
ADFLLPAEVTIMEPILRLLQLLCENHNPALQNFLRCQENRTNYNMVTETLMFLDTICGST
SGSLGLLHEINEHNVSLVNQALISLTEYCQGPCHENQNAIAMHESNGLDIIISLVLNEIM
PLAEKNIQLALEIKSNASKLLLAILESRNDCDNAERILRNMARMAGGAEQLVSAITDVFK
LPEISFNHSGYAEKIASQFDTPKIVFETKTDINGNPVENDGYCEVSPSEVGHNIYILAHQ
LSKYYPKLNSMLKPSNARDEISRSALQFYTDHTAHIEVVRSDRSLELIIFPVPHVCKFLT
EETKERVFLKTERDLQGSKVPEFFANFDTLYNEIVWQQKLRDKPWLYKCSRSVPIWMRMS
FIFAMILNFLVALFYPFDSAFGGSGFYLLCLLATTTYTFTAPTWTAVAVTSTFVASSCVS
LFGVTVASYLFGLLQIANNIVHTVGIIGSYGPMKLTLASFLSNSNVVYNMFYLLLCLCGL
FVHEFFYCFLLFDIVLHEETLCNVIRSVTRNWRSIALTGILAVILVYTFSMVGFVLFSND
FWIEVEPNDQTCAQSENCTETTNVPGEPVKVPFCESLRTCILAVLRWGLSSGGGIGDVLR
KPHPQEPLFYMRILYDLSFYFILIVIVLNLIFGVIIDTFADLRNEKQENEEIIRNTCFIC
GLERSHFENKPVSFDEHIKNDHNIWNYFYFYVLLNTKSSTEFTGPESYVYDMIKEGNVDW
FPRMRTMKLAIQEGDSEQTEVKILQRMICERQEEISNLAARIDELKQMVLKLSRSK

BLAST