GenomeNet

>tr:A0A0V1LTA1_9BILA [A0A0V1LTA1] SubName: Full=Ryanodine receptor 2 {ECO:0000313|EMBL:KRZ62741.1};
MTDFQENSTGEQDDISFLRTGDVVCLTCLAPCKESGTGSAERVSLAAEGFGNRICYLENV
SDKNKPPDNATSMFYIDQALSVRALQEMMSSESPNISGSSSTHRTLLYGHAVQLKHALSG
MYLTCLSTSSASDKLAFDVGLCETNVGEFCWWTIHPASKQRSEGEKVRFGDDVILVSVAT
ERYLHMSSTNGNTVLAAFHQTLWSITPNSSGGVRERHMGYVCGNDVLRLNHGNDECLTIP
ENWSDSHQNNIVIYENGKSCNQARSLWRPELIHGKWQSSLIGWEQAFRIRHITSGRFLAL
NEDNQVCLLHKDRASFESTAFIMISSKDVKRSTFEEKEEEGMGVATVKYGETVIFLQHLQ
SNLWLSCQTTAVTKKNMGKVEEKKAIAVEEARMDDCFILFKAQEEESQSARVIRKCSQIL
NRFLRGLEGLQMEGKDSLAWNRADLSETVKLMEDLIQYFAQPEESIDFESMQNGLRALRN
RQDLFQEEGLLNMIIDTIDQFSAVESMTELLDVTKEDKCKNWQDISTYLYLLVAAMIKGN
HSNCTQFASAQRLNWLFSRLSNPQSAEGILDVLYCILTESPEALNMINEDHVKAVISLLE
KVGHDPKVLNVLSALCEGNGVAVRNSQNVICSELLCNKKFLLQTKMIDQVSSVMANIFVG
SYENSAMYPRWYFEAELEYMESMRTSGQKPHLRIGWASSAGYRAYPGSGKKWGCNGVGDD
MFSFGFDGQYIYAGIAALKLSKLIGGIEKFVGTHEIRKGDVIGCSIDLAIPEIQFSLNGH
QIGTSVRNFSSCDCLFYPVMSLSAIVSCRFFFGGSQGKLRFGPKKGYLPISEAAITPVKL
ISCISFGDTRKGYFSGPSTVISDYIVFQPKPIDTKDVSLPKHLEDVHEKLAENIHEVWAM
DKIEKGWIYGERRSETQKTHPCLTSYERLPTAERSYNLNLAKETLKTIVALGYRIDIGKA
SNRVKTFRLGQNFLMSNGYKPAPLDTREYELNETLETLVDLLAKNMHNIWAQSKIQRGWT
YSKNENVNIKTTSHLVAYDFLDPNIKAANRDKAGQIIRSLLVYNYCIEPPTAEQDEGAVK
QSQVMNLQKRTYRFEKRYAVKSGKWYFEFEVRTSGFMNVGWMDVSASPDGDFGLHKSSYA
YDGYLGRKWHGESESYGKKWNVGDVVGCFLDLTDRTICFSLNGELLLDSSGTEVAFDNVS
AEDGFVPAFSLAPGQIGRLNCGQNVNTLKYYTTCGLQEGYEPFCIRMSRQAPMWIAKCEA
EFDEINEEEKRFKVTRIPQSGDNPPCLKLQCKSAGMLERCSLALFRLNLPVFCKEANDNR
VCNQYFTETLSERNAGKRNGESDRTAESSRRGKMKGIRGSRNQDENISFHDQQNYADQYE
VSNHAVMKSNCLVQKTFSLDDDSSEVTENRFRKAPRLRSSASEANLKEKESIDSQDKISA
SYAVSNTKRNLRPFKVLQSFGQRMRDVSVGRSRKQNARKLQEACASKSKIRSDENDKFSS
GHLKSRKLDDRVADVDSTESLDMPKSGPGRRPTVIRLESDSKVKKRSNYFSSGHDLLVEA
SKLSAPSGNQHVSIGASVSFYSTPDDYYFGVRVFPGQDLANIWIGWLTPQFSFTGSQIAA
DSQRICFLESTHSTLDNIQEFRSCYIVNGMELLTAAGGSSSVSKMAGILAGCLINTATGE
LKFHVNGKQTEMSYRVEPGTILYPAVFVLPTSREVLQFELGNIEKTLPIASAQLNERSNA
VQLMCPPRLKMEICKTRTWLRVPDQCARVTSLKLSDTRGWSVLCDDLVRTMMLYVPERDS
SIDILELAEHESLCTFHQQTLRLYCSLCAQGNFKIAHILCQHVDEDQLMYAIQSKYLSGS
LRQCFYDVLIAIHLKCHYDARLAESHEYIIPLNAKLKDRNYFNYETKSVYPHALNSDITL
KSSINVMEVKKKISTEDEKFLMSPTFDFHTLKQYVVDALEEATLEALMNSRDLIGGTNTT
HFLPILKLFDTLLLVGVLSDTDIHRFFRLLNPKSFQETLDSPQNVKGLVDLDLDEMVQLE
LCHIMNHLCDLQLQGRVESLINFAETFVGETQNACALDEIFEKSNLCFNYLRDQLRRYLE
IKQTDMPSAEAARKTKEFRCPPKEQMLKLLDFKADRDEQTDEEGELEVSAMSEFLQRVLR
EFHCNMVKFIGNSDKNDDNYSANVEQKQLESENMNWVEKLAWMVVPVPPALLSEDERIKF
DGEEAFRNIILSTLIKWTGNKAIDDPNLIREIFGLLLRQYTRISEVKSALKTAYCIHERS
IEDVQSFLDNLCQIRRLLCVQFEATEEEVLKNSLWDMMNNKVFFQHPDLMRLLKVHENVM
TIMVNVLSRAQKSELDDRRNRSAQDDMKKAFQNSISDLVVACCKFLCFICRSSTKNQAAM
FEHLPFLLDNATMLLAKPSLRGSVPLDVAYYSFMENSELALALKEDDLEKVAFYLSRCGL
QANAEMVFKGYPDIGWDPVEGERYVDFLRFCVWVNGECVEENANLVIRLLIRRPECLGPA
LKGQGEGLFRAFKDAISLSSEISNLHKGRDLRSRFNFDLSHYPNPEIEEEDYIDLGAAIL
GFYSSLADLLGKCAPDHLTVKSGKGESVRLRSILRSLTSVEDLEAILALRFLLPNVFAAK
EESFRSSSIGLLPCHKQSILLFLERVYGLIDKEMVFRLLEQSFILDFRAATILDHPAYAE
SDLALALNRYLCGSVLPLLTSHAHCFADAEHYYSLLEATLHTVYRMSKIKSLTKSQRSAI
TEFLLAFTKEIHPGMMKKLLQKVVVDISSLNEFATVPLQIMTQHYECFSKHYGISMHEDT
ASEEQKRLSMLLFTTIFDSLGKRAFDSDLFASALPCLTAIGSALSPDYAMQSYAEEEIQN
MNVPSGHMEVWRPHPVDASNVQLSVNLQNLVQRFAQHFHDSWASRKLEKGWRNDDIYSRT
NCTHPRLKPFGMLKEFEQNFYKERCSECLKALLAWGYSIEQETQVSSVQPKSMNPTSNVR
SASVFCPQPIDLSNMTLSEEMCELAERIAENSHLIWVSKTIEDLNDANTGIMVLLVPWDI
LADSEKRKHRFRAQEVLKFLQYQGFRLKSPLHRAREEYQQTVVDSNTHRPVEKRFACNLL
EKLLAYLENAAQKMEVIKPSKQFSRYRNYTLPSEDVKFFGKVLLPLLESYFRSHRNYFTA
ASSASLSGVASIKEKEMVAGLFHRLMSVFRSKHNAFGCHVKSTVRCLQVLLQAIDFRSLV
KINSDTLRTCAQIFLSNMVSDLMNITKEIKNNGRYAEIKGKTLPCTSSLLFLYEAMLPLL
TTLFCHLSKHGHGQDFLVNDIQVGCYKIADCLYMLASPITISRKSVKEEMEKHRSSIGQC
LSAFACCFPVAFLEGDFNPNSRGSTVDRQHLLSESKDTSSSLLLNIPSLDNLLSNIEQLS
NTNGKYQDAPAIFDVDIPMLCSYMSFWWQHGPTNNTQELIKFIFMCIMMLYEIYFRKNLS
AVSSDHINRLFSACSRLICDHIGIAHADWICHLAPFITPMINYVTIEPVRDYLLPMAEKV
RMQADLAFKEEEKHRMHPDVFDESTVIELHSILIRDVYALYPILIKFTDLHRARWLKNPC
WETNALFEHVAFVFKLWSTSQHMKREELNFITQFESDFMTGTSRKTGKAAVAFRKKKRRE
GKRREKDSGSIVVACLKRLLPVGLSVFGGRELDLLQKVKEKYMKKENDEKIKEYISSSLA
IPDQEDVFDKSHWQRKLYQQIGKAQMLGIDSMSQEMVLDKIIFMGVTLCNLHNVEHPQTF
QADAWRKIVSSQRKRAVVACFRMVALYSIPKHRCVNLFLSAYIEKWLKSEKVDEDLLISE
VTVASEGRMQRLREDVEEVDEQCPPDPLSQLVQCFQRAATSERKQLVPIVDDNLYIQYVR
VMASSIHINDDEQNNAEDDAISMEAQELEKQQLLHEQSRLADRGVAVMVLMYLSACNGEP
NVMVEKTLALGIHILNGGNSDVQNIMLNYLQEKKDVRFFSSISGLMNRCSVLNLEIFERQ
LKAEGLGMGAELSVGKHQNLNDSEFICSLFRFIQLTCEGHNSEFQNYLRNQPGNTTSINL
IICTVDYLLRLQESIMDFYWHFSSKEVVDEAGKAHFLKALSVCSQVFNTLTESIQGPCVG
NQMALANSRLWDAINGFFFLFAHMMDKLSKNHTQLELLREFLSLQKDMIVLMLSMLEGNI
LNGSIGKQMVDTLAESQQNVQLILKFFDMFLKLKDLTTSQAFQEFDTNKDGWISPKEFLR
AMEAQKMYSTEEINYLMMCTDVNNDGKIDYMEFTERFHNPAKDIGFNLAILLTNLKEHIT
GDSRLDQILQTASSMCEYFDPYLGRIEIMGSNKRVEKVYFEIKEEWLEQFNKPQIKQSKK
DFLFNVLQDDGGEQGKLEAFVNFCEDTIFEMSHAAEISSEDRDSRIERAKKQREIFTGMA
DKTDTISAFDIILKIMKKMGTSIVSFCRYLRPSELRQLKHSAALHFSSMTYGQLILIFLK
IVLFIFVTIFRGAFYLINTFFRFILLMMYGVWEEEKASSKLTAENAVHHTLPKDFNIVPQ
LYEPEKPEVYEAFGIQLTQGIGEGLSMKNPNNQPQFEKSFSMHIGNSSPFSFASAESASA
QNERQLMIYSNQIPETYTPAAVSVCNDDSNIVVKEIYEPKIAETTSSAKGSAFNFLARNF
YLLKYITLALAFCINAILLFYRVADNPSNDEKVVLEADNSKLQNEEHMENGIEEELAIHD
NYYYLAHMLIFLSVAHCAASLALLIAYYQLKVPLIIFKREKLVARKLEFEGMWITEMPSE
DAVSGKWDSMIISSPSFPEKYWDKFVKKKVKDKYRDQFDEEELNRLLGLDKTVVDGSNSS
SSSGVDWCYQIWKLGVIFTDGSFQYLLMYLFFSAVGIWNPFFYAGHLIDVVISFPMLQTI
LKSVTHNGKQLILTVMMVLVVVYLYTVLAFNFFRKFYVQEDDGEETDSKCNNMISCFVFN
VYAGIRAGGGIGDELQSPYGDEREAWRILFDMTFHFFIIIILLAIMQGLIIDAFGDLRDQ
QESAQDKLESNCFICDIGKDFFERLPHGFDHHTTKEHNLAYYLFFLMHLINKDDTEYTGQ
ETYVWELYEKRCWDFFPVGECFLKQYEEQLMAS

BLAST