GenomeNet

>tr:A0A0V1N1C2_9BILA [A0A0V1N1C2] SubName: Full=Ryanodine receptor 44F {ECO:0000313|EMBL:KRZ77566.1}; Flags: Fragment;
LPSLSLTRSTFTQKMTDFQENSTGEQDDISFLRTGDVVCLTCLAPCKESGTGSAERVSLA
AEGFGNRICYLENVSDKNKPPDNATSMFYIDQALSVRALQEMMSSESPNISGSSSTHRTL
LYGHAVQLKHTLSGMYLTCLSTSSASDKLAFDVGLCETNVGESCWWTIHPASKQRSEGEK
VRFGDDVILVSVATERYLHMSSTNGNTVLAAFHQTLWSITPNSSGCVRERHMGYVCGNDV
LRLNHGNDECLTIPENWSDSPQNNIVIYENGKSCNQARSLWRPELIHGKWQSSLIGWEQA
FRIRHITSGRFLALNEDNQVCLLHKDRASFESTAFIMISSKDVKRSTFEEKEEEGMGVAT
VKYGETVIFLQHLQSNLWLSCQTTAVTKKNMGKVEEKKAIAVEEARMDDCFILFKAQEEE
SQSARVIRKCSQILNRFLRGLEGLQMEGRDSLAWNRADLSETVKLMEDLIQYFAQPEENV
DFESMQNGLRALRNRQDLFQEEGLLNMIIDTIDQFSVVESMTELLDVTKEDKCKDWQDIS
TYLYLLVAAMIKGNHSNCTQFASAQRLNWLFSRLSNPQSAEGILDVLYCILTESPEALNM
INEDHVKAVISLLEKVGHDPKVLNVLSALCEGNGVAVRNSQNVICSELLCNKKFLLQTKM
IDQVSSVMANIFVGSYENSAMYPRWYFEAELEYMESMHTSGQKPHLRIGWASSAGYRAYP
GSGKKWGCNGVGDDMFSFGFDGQYIYAGGIEKFVGTHEFRKGDVIGCSLDLAVPEIQFSL
NGHQIGTSVRNFSSCDCLFYPVMSLSAIVSCRFFFGGSQGKLRFGPKKGYLPISEAAITP
VKLISCISFGDTRKGYFAGPSTVISDYIVFQPKPIDTKDVSLPKHLEDRRSETQKTHPCL
TSYERLPTAERSYNLNLAKETLKTIVALGYRIDLGKASNRVKTFRLGQNFLMSNGYKPAP
LDTREYELNETLETLVDQLAKNMHNIWAQSKIQRGWTYSNNEVRNVNIKTTSHLVAYDFL
DPNIKAANRDKAGQIIRSLLVYNYCIEPPTTEQDEGAVKQAQVMNLQKRTYRFEKSYAVK
SGKWYFEFEVRTSGFMNVGWMDVSASPDSDFGLHKSSYAYDGYLGRKWHGESESYGKKWN
VGDVVGFSLNGELLLDSSGTEVAFDNVSAEDGFVPAFSLAPGQIGRLNCGQNVNALKYYT
TCGLQEGYEPFCIRMSRQAPMWIAKCEAEFDEINEEEKRFKVTRIPQSGDNPPCLKLQCK
SAGMLERCSLALFRLNLPVFCKEVNDNRVCNQYFTETLSERNAGKRNCETDRTAESGRRG
KMKGVRGSRNQAEDISFHDQQNYAEQYEVSNHAVMKSNYLVQKTFSLDDDSSEVTENRFR
KAPRLRSSASEANLKEKESIDSQDKISASYAVSKTKN

BLAST