GenomeNet

>tr:A0A0W1FFL9_9SPHN [A0A0W1FFL9] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KTE41419.1};
MDVAPAGGRVTIALAPCPVPSSADSFIGGTLAAIECQAQTIGNAGYLALSGPGSGIAAFL
TAMLTIFIALIGYRMFAGRGPDLGGGLLIFAKIGIVVALATSWPSFRTLIYDVAIDTPAQ
IGATVGSAASLAGSDLSLSTRLSETDRAYRTLTAWGVGSEPARAGVSDSEGIEPDTTYET
KALGAARMGFLTGALGSVALTRLAAGILLALGPLFIAFLLFDATRGIFGGWLRGLIGLTL
GSTASSLVLAVETAIVQPRIVALITLRASGYSIQGSATELLALSIVFAFVTLAILCVSFY
VAAGLRLPQWQWAQNYLPASMRGSGSGADRGAATQPADRNDPRSRAAVIVDAVEAMQRRE
ASTGPGRGGGNDRARAVASAASGTAASRDAQRASTDTGGDAPARRRTTGRVSTSGNRRDT
R

BLAST