GenomeNet

>tr:A0A0W1RSU2_9GAMM [A0A0W1RSU2] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KTG16497.1};
MPMQQIPLALDLVTPTSFEGFIGNENLLLKATLAEQAAGHGEAQVFIHGPAGSGKSHLAQ
AACYHAGSMGRPAAYWPLRQIGGQLAAASEQIDAFALAVIDDVDALIGQDEGEFLLFDLI
NRAREAEVPLLLTASRPPADLPVRLADLASRLSWGAVMAVHLPGDGEKIELLRARAQSRG
LEMPHATAQWMLGHLPRDVGTLLDALDRLDRQSMIAKRRLTIPFVREVLVEAD

BLAST