GenomeNet

>tr:A0A101G3C5_9ACTN [A0A101G3C5] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KUK49304.1};
MSSAHHHSSIDARYHLAALATLLVLALPAAAFAAAPTTPLLADVYVDGTGSVTVEWNAST
DADGDPVTYTVYRLQQPITATNIGSATAVASSVPGTSATVSAHADEIAQSYVWFYAVRAS
DGTNLSLVSKSMAPNLHGYRLSSATVSCTRCHEVHGAYPADWDYTYVDLCYSCHGATSSA
DAVGAKSSLNVQAEFGDYDGQTQPASVHRSTKMETDRTECDACHSAHRSPYYYDNSGNYV
AASSYRKMIRVQTGEDAGGPLYTYYSLNTDTAENAAFCLACHGADATPIGYVGDADDYAG
TGGDHNSAGYDAAAHGPSVVYSNDHGRTNASEYPQVQCLACHAKHASAADKLIAYRGDDT
ATSPSGTYAEAELCFACHSSSSSENKVAASYAAPFSWNDRDVEAEFGRASTHPVSSSATG
RSLTCASCHNVHNVTEGGTAAWNVARVSTPSNTKATPADMTAFCLGCHTTTPPSATIAAD
TLVPYRIGFSDQSAAPYFPGWDKSGFGSLGVGETNHYTPATGGQPALCKNCHDPHGSDYE
RLVAWSAPTGAEKVGSWTPNSGTRENDSATAAALSAEENLCYQCHGNGATGQRADGAKDV
ATKAGLAYAHDPADTTGAHSDTESGADIGAAPHAECTDCHDPHMTKADSSGSAVHAANPA
ANSSAPGTALLGAWGAAPGYSARALSNPGTLNWSAPGASDFTAVRFSGAVTDMEAYLCFK
CHSQNVGTTMITGLTDTAQEFNPSNFSVHNVTGQSVGMQNAFTVGGSPYTWQTPQSADFL
QAGWTTDSMMTCTDCHTNAQESATQAVGPHGSSAAWIIAPWGSNTTIADWKTTIISTTRD
SGMSNDTNICAKCHTNLDTANNVHPSHNSSARGQCNYCHTAVPHGWKRPRLIGYMTDGPY
SSTGLSAVALMNHAPTGWNKAYCNASCGGGHTYTGSAW

BLAST