GenomeNet

>tr:A0A106BIY4_THIDE [A0A106BIY4] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KVW93336.1};
MDLDELMDRSTQPVAAPDTVDDAMDAYSGAQTGAVRAGATLALDSNPDEIARQKRIAQSL
GVPLAAVEADPEFATREQRVRSIEQATANSPALRQKFSDADFAKLAADNVDNLSGIEQLL
RSAKRGFTAGLRGMDAAAVDDSARILTAIDTIERGGALSPNDPLASMFAGSGRSPDNLAQ
MRAKHQGRVTENVGEYGKRTQALTKLQPTGATADFYQAKGWGDSLSALLSDPFEISANVA
TESLGLMAPALPMIAGGGLAGGARGLAGMAGATSTNAEYSTAIAEALQASGVDLNNLEAV
QAAVATPEFAETRRQATIKAATIGAFDAATAGMAGVRLRPSMAGNLAAQTGVQATGGAAG
EVAGSVASGQEVNASSVLAEAIGEMPSAMIDVAMMAGKRTLEGQRKADQAEQQGAFIKNL
NKLAAADKLLARDPETFQSFIAAVAEDGPVQNVFIDGRTLMQSGMAPRLAELSPAVLEQL
DRAILTGGVIAIPVDEYAARIAPTEFAPQLLDHLKTDVEGFSRAEAADFMANQGAELKAE
FERVIGTQSDADTFRASHDVVKQDIIGQLNTAARFTPQVNDAYATLVAARTAVRAAQMGM
TPEAFHQKYGMNARGAEVAGDKFDQAGVSFKEGSRGSRSGQTDMTLTADAGGESVGRIDY
SVYQGRPSVQMIDVPEGKRRKGYATEMVKQLQRQFPGVEIDFGGLTEEGAALYKALAKTT
EPSEYAPAFDELAAAIAERTALEEKNAQLEGTAERGAWIAQVGDRWNELHDIISDLEGEI
FNKSPTKNLINTFDPADPSILNQSANRSLYEKAWKMLAGNEAIFQNPMPDSFDMEGAARE
IDPGMSAVADKPDLDEQKTGITKKWYVTMPDGTHAYVMENKQGEVWLDASRLEEGASGGA
KLYLLVGSYAEGNGKVFIGDPAGLSDVALIRRTENMLSLALRFGKTSFMRPHEYQMNPDA
KQGTVLAGVVKPLEWVEGNDANNIEELIRTSYANTVKLVAEVKDVTFNFDKQRFEQDGVE
FTKDGFKRLVDGLPGALRKRGLSKIVTTRNPGGKGGAAEDFAPIGIATLKRAAVTNTLAR
ETRAGRGGDLLAEIGRFVSGELTGLAGTLYQPGGGNTAPRGSFSPATNTVTLLQNADLST
FLHESAHYFFESDIQLASELAGKAEPTPGEQQIVDDVSRLLTWHGINGDVTEQLRTWHTM
DFEEQRSHHERTAESFEAYLFSGQAPSLELQPMFQRFRAWMVNVYKSIKDFLAKNPEAGK
LNNEVRSVFDRMIATQEQIQLAEQARSLTALFASPETSGMTADAFAAYQALGTDATNTAI
EQLQAKGLRDMQWLTNARGREIKKLQKESKAARAEVTMEARGEVMRQPVYRAWDFLTRKL
SDNDKLPPLERKSDPDVLDPTLDSLFVAIAKLGGIRKDQVLSEWGADPKDIPQSGLFGKP
VWRVTEGLPIDSMASALAEHGYLPLNEHGQYELNDLGDRFLAELSGDTQYSHAYQPQDLL
PGEQIATPDGLMAGRIEFAGLAAIGIPEEIAAHLKTLKMTATDGLHPDLVAVLFEFSSGD
ELVRTLAAAPTPKDAINALAEQMMLERFGELSSPDAIERAADQAIHNDVRARMLTTEVNA
LAQATGKPKILASAAKAFAADMIARLKVRDVRPGQYANAEARAAKAAAKAKGDIATAAAE
KRNQVIQHYATSAAYDAQDEVKATLRAWSKLVARKDSTKSVDIDLLNAVRAILGEYGIAP
KRAERASEYLKSVQAYDPEMYAVIQASVERAEANAKPVKELTLDQFRGLRDEIDSIMHLA
KRSRQMEIDGDLLEIADIQDALVERMTDYGIPETIPGEGQAVTPAEQRMNKFKSLLAFAR
RVESWVGQMDGTQQMGPFRRFVWSRISDAAVAYRVDKAAYMKQFRALVESIAPTLKPALI
HSPELGYTFGKDSGGSAINEILHAVLHTGNESNKRKMLLGRGWAVEVAPGQLDTTRWNAF
IARLVAEGKLTPAHYDFAQGAWDLLESMKPLAQKTHRDVFGRYFNEVTANPFTDPFGVTR
AGGYVPAMVDSRIVKDAELRKLADEDNAAMSYAFPTTPKGFTQARTEYNKPLMLDLRTLG
QHVDKVLLFSHMEMPVREVQRVLSKRVGETLNRIDQTAISGMLLPWLNRSAKQQVETPIA
GSAGTMRFFSVLRSHAGMAAMFGNLANTVQQLTGFSLAAIKVKPSLLLAATVDFTKAPRE
FAQAVSETSAYMNTRMANEVYAMTDAINDILLNPSLLEKGQAWTMRHAYFLQSAFDNSMS
PIIWTAAYNQAKQGGETHADAVRLADGTVRETQGAMQAEDIARFEGGNAFVRMFTQFAGY
FNMNANLLGTGYAQLMHNGGLRKNAGRGVFLFVFGFMIPAVVGELIIQLFRGGPGDDDDD
GEYLDDWIAAVFGWAPLRYATAMVPIAGQVVNAAVNSWNSKPYDDRLASSPAISMLESAA
RAPVSVYKAIDGDGSAQKAVRDVATLMSMTLGLPANLAARPIGYGVGVMDDATDPTSGFD
FARGILTGQVSPDSKQ

BLAST