GenomeNet

>sp:A0A135I8G0_9GAMM [A0A135I8G0] SubName: Full=DNA mismatch repair protein MutT {ECO:0000313|EMBL:KXF81735.1};
MRILAILWISLASFTSWASTNAINSTLPIEAADCLIVDHDNNILMIEEALSGKLSIPGGS
IIGKETPQEAAKRETLEETGLNVDVGEKIAQTYNSAVYACKVLGLPEYYDDANGQRQIYA
WHAPHFGKEVTRVMLMPDDGAMRAKYRFPEHKWMFDKWVKFVEPSRFRQTPDAHSELTAF
YDIQLAWLEKLRAKTFNGGLSSLLGNVVVLTGSIITPLFFLLMLPLVRTLFGHRALLIFS
AGMLTLATVTLMLSTVIHVPRPLSVDPYFTYHDVLGFTLPSSMVALTTFTFSCAWLFWDE
DKYPKKRLWVAAVGVVLVGASSLKALLLGEHYPSDMIISILLGVLAAFALLKVKDWRFAD
RSRVLTSTRFWGGAFVVVAVIGSIIHKPQLIYLSGLTLGAFCALIWLKVSPVYISPVRRR
YKIAFFAIASGGIFALMYLDKHLTANTAINEIIVLWNCIALWSISVWLLVVLPRLFYRYV
KR

BLAST