GenomeNet

>sp:A0A135LDH0_PENPA [A0A135LDH0] RecName: Full=OBG-type G domain-containing protein {ECO:0000259|PROSITE:PS51710};
MSTTIEKIKEVESEMARTQKNKNTSYHLGQLKAKLAKLKRELLTPTGGGGGGGTGFDVAR
TGVASVGFIGFPSVGKSTLMNKLTGQHSEAAAYEFTTLTTVPGQVMYNGAKIQILDLPGI
IEGAKDGKGRGRQVIAVAKTCNLIFIVLDVNKPLVDKRVIENELEGFGIRINKKPPNIVF
KKKDKGGIAITSTQPLTHIDNDEIKAVMSEYKISSADISIRCDATIDDLIDVLEARSRSY
IPVIYALNKIDAISIQELDLLYRIPDACPISSEHGWNVDELMEMMWAKLKLRRIYTKPKG
RAPDYSAPVVLRSYACTVENFCDAIHRTIKDDFKHAIVYGRSVKHQPQRVGLSHELADED
IVSIIKR

BLAST