GenomeNet

>tr:A0A136Q060_9FIRM [A0A136Q060] SubName: Full=Cupin domain protein {ECO:0000313|EMBL:KXK64078.1};
MNEQVKQIAARIRELREILDIPQEEVAKKVEVSLGEYQKYEQAEDDIPIGVLYGVAAELG
VDPTELLTGEAPRMDEYTIVRGGNGVSVERYPGYAFTALAYNYKNRDMEPMIVTISPNDE
AELVTHSGQEFNYVLEGAIKVVIRGREFVLKAGDSIYFNPELPHGQRAVTDVAKFLTIIN
E

BLAST