GenomeNet

>tr:A0A137SWA4_9FIRM [A0A137SWA4] SubName: Full=YheO-like protein {ECO:0000313|EMBL:KXO16734.1};
MEYEFTRNDFLMENYKVLARFLGSYLGPDYEIIIHDLSLLPNTIVEIVNNNLSGRNIGGP
ITKSALKMIQEKVYEKEDFIVNYKGMSGDKIFRSATMFIKNEHAEVIGLLCINFTDERYI
SLLENITKSFHPKNWEYTKIIKDKKDVVDNNTAIVEEYYESMDELMKNIFSEVIADIKIP
VDYLKAEDRINIVHELSKKGMFKLKGAVPFVAKNLQCSQATIYRYLNQ

BLAST