GenomeNet

>tr:A0A137SX75_9FIRM [A0A137SX75] RecName: Full=FeoB-type G domain-containing protein {ECO:0000259|PROSITE:PS51711};
MKINIALAGNPNSGKSTLFNTLTGANQYVGNWPGVTVEKKTGKYKKDKDVEFTDLPLYPL
TLWKKLYPEIFFCMKSRM

BLAST