GenomeNet

>tr:A0A140L911_9CLOT [A0A140L911] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KXG77036.1};
MSNEIHPILKSMIPIVEGIAKTFGKNCEVVLHDFKNFQSSIIAIENGHVTGRSLGSPMTE
VGLQAIRKGNTNDNIINYTGKSTDGRALKSSTMFIKDENEHVIGCLCINFDMSELIVAQN
AIQELTQTESKEDVKQNDYLTNSVNDVLSSIVSNTLEELGKPVAYMSKDEKVNIVKKLDD
QGAFLIKGAIDYVAKVLCVSRYTIYNYLDEIRVNK

BLAST