GenomeNet

>tr:A0A150V5K0_9PEZI [A0A150V5K0] SubName: Full=Glycoside hydrolase family 35 protein {ECO:0000313|EMBL:KYG45818.1};
MKWAQSIALLLATAVAVFATNDGLTTAVTWDPYSLMINGERVFIFSGEFHYERLPVPELW
RDVLQKYKANGLNAVSIYFFMSYHSPRRDVFDFETPGRDLQNLLDIAKEVGLFVIARPGP
YCNAETNGGGLALWGSDGSMGDLRTSDETYYQSWLPWITNVGKILAQNQWPHGNVILDQI
ENELQETDHSPTNTLVIYMEQIENATRNAGVVIPFSSNEKGERSESWSTDYEDVGGAVNV
YGLDSYPGGLSCTNINSGFNVVRNYYQWFQNYSYTQPEFLPEFEAGWLEGWGTYWYGQCV
EEHDPAFADVYYKNNIGQRVTLMNLYMAYGGTNWGNLAAPVVYTSYDYSAPLKETREIEA
KFQQTKLIALFTRVSQDLLETYMESNGSGNAVSTDEIYSWVIQNPYNGARFYTLQQTSTP
SRSVVTFSAYFNTSLGTVTVPNVQLNGRQSKIATTDYHFGQYTLLYCSSDILTWGDFDGS
TVLVLYLDIGQAGEFAFKDVPSHLSYQTYGSSNVSSSSGTVNGTSSDTSSPFTKYTWTQT
AGPTVVKFSNGVTVYLLDLDTAWTFFAPATTSNPHILPDEQVFVLGPYLVRDVTVMGGTI
ELQGDNANTTSLEVYAVHADTVIWNGRRLATKRTPYGSLIAYVTGANDVEVTLPTLSWVV
ANSLPEAERDYDDSKWVICNNSTTLSPVSPLTLPVLFSSDYGYYSGVKLYRGYFDGTGAT
SANITVQGGAAAGWSAYLNGKYVGSNTGNPSLWATSGVLDFSNATKYNTSNVLTVVTDYT
GHDETSTGPMGVENPRGILGAYLYAGSNQINFTQWKIQGNAGGPANIDPVRGCLNEDGIH
GTRLGWHLPGFDPTGPAWSTGSPLQGLNQSGINWYISHFKLDIDSDLDVPLGIELNAPAG
TEASVQIYMNGYQYGKYIPQIGPQTRFPIPPGIINNQGENTLALSLWAQTDAGAKLSNVT
LFAYNKFQTSFDFANIGGGLQPGWTPSRLQYM

BLAST